SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001163 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001163
Domain Number 1 Region: 102-323
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-56
Family DBL homology domain (DH-domain) 0.0000955
Further Details:      
 
Domain Number 2 Region: 313-450
Classification Level Classification E-value
Superfamily PH domain-like 8.66e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 450-522
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001163   Gene: ENSMGAG00000001652   Transcript: ENSMGAT00000001815
Sequence length 552
Comment pep:known_by_projection chromosome:UMD2:11:2411195:2435330:1 gene:ENSMGAG00000001652 transcript:ENSMGAT00000001815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAAEDSPTAAEASPPAHPMTADSWRNLIEHIGLLYQEYRDKSTRQEIETRRLQDSQTDP
EESSPSEETPPETEPASTPESKAAPQFNLLRNSNSRFNLWQDLPEIQSSGILSILQPDEI
KLQEAMFELVTSEASYCKSLNLLVSHFMENERLKKILHQSEAHILFSNVLDVKAVSERFL
LDLERRVEENIVISDVCDIVYQHTVDHFSVYITYVSNQTYQERTYKQLLQDKPAFREVIT
QLELDPMCRGLSFSSFLILPFQRITRLKLLVQNILKKVEEKSERETTALEAHKELETVVK
ACNEGVRKMSRTEQMISIQKKLEFKIKSVPIISHSRWLLKQGELQQMNGPKTSRTLRTKK
LFREIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQSLANVFILRLLENA
DDREASYMLKASSQSEMKRWMISLAPNRRTKFVSFTSRLSDCPQIQCVHPYVAQQPDELS
LELADVLNILDKTDDGWIFGERLHDQERGWFPSSIGEEILNPKIRAQNLKECFRVHKSDD
SQRRKLGSRNRQ
Download sequence
Identical sequences G1MSA1
ENSMGAP00000001163 ENSMGAP00000001169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]