SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001169 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001169
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-51
Family DBL homology domain (DH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 188-325
Classification Level Classification E-value
Superfamily PH domain-like 4.98e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 324-397
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001169   Gene: ENSMGAG00000001652   Transcript: ENSMGAT00000001821
Sequence length 427
Comment pep:known_by_projection chromosome:UMD2:11:2412036:2435330:1 gene:ENSMGAG00000001652 transcript:ENSMGAT00000001821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFELVTSEASYCKSLNLLVSHFMENERLKKILHQSEAHILFSNVLDVKAVSERFLLDLER
RVEENIVISDVCDIVYQHTVDHFSVYITYVSNQTYQERTYKQLLQDKPAFREVITQLELD
PMCRGLSFSSFLILPFQRITRLKLLVQNILKKVEEKSERETTALEAHKELETVVKACNEG
VRKMSRTEQMISIQKKLEFKIKSVPIISHSRWLLKQGELQQMNGPKTSRTLRTKKLFREI
YLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQSLANVFILRLLENADDREA
SYMLKASSQSEMKRWMISLAPNRRTKFVSFTSRLSDCPQIQCVHPYVAQQPDELSLELAD
VLNILDKTDDGWIFGERLHDQERGWFPSSIGEEILNPKIRAQNLKECFRVHKSDDSQRRK
LGSRNRQ
Download sequence
Identical sequences G1MSA6 Q5ZK41
ENSMGAP00000001169 NP_001010841.1.86415 ENSGALP00000040510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]