SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001220 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001220
Domain Number 1 Region: 4-185
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.84e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000000745
Further Details:      
 
Domain Number 2 Region: 180-303
Classification Level Classification E-value
Superfamily E set domains 3.03e-43
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001220   Gene: ENSMGAG00000001721   Transcript: ENSMGAT00000001872
Sequence length 592
Comment pep:known_by_projection chromosome:UMD2:2:382585:410526:-1 gene:ENSMGAG00000001721 transcript:ENSMGAT00000001872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GISEPYIEIFEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNKTFPSIQILNYFGKVKIRT
TLVTKNEPYKPHPHDLVGKDCRDGYYEAEFGPERRVLSFQNLGIQCVKKKDLKESISLRI
SKKINPFNVPEEQLHNIDEYDLNVVRLCFQAFLPDEHGNYTLALPPLISNPIYDNRAPNT
AELRICRVNKNCGSVKGGDEIFLLCDKVQKDDIEVRFVLDNWEAKGSFSQADVHRQVAIV
FRTPPFLRDITEPITVKMQLRRPSDQEVSEPMDFRYLPDEKVDPYGNKAKRQRSTLAWQK
LIQDCGSAVTERPKAAPIPTVNPEGKLIKKEPNMFSPTLMLPGLGTLASSSQMYPACSQM
PTQPAQLGPGKQDTLHSCWQQLYSPSPSASSLLSMHSHNSFTAEVPQPGAQGSSSLPAYH
DNPLNWPDEKDSSFYRNFGNTNGMGAALVSAADMQSVSSSSIVQGTHQASATAASIMNME
TNDMNCTSLNFEKYTQMLNVSNHRQQLHQVPATCPPVAAPGSTPFSSQPNVADTAVYSSF
LDQEVLSDSRLSTNPLQNHQNSLTLTDNQFYDTDGVHTDELYQSFQLVFFHV
Download sequence
Identical sequences G1MSE1
ENSMGAP00000001220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]