SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001378 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001378
Domain Number 1 Region: 154-333
Classification Level Classification E-value
Superfamily E set domains 4.25e-52
Family Cytoplasmic domain of inward rectifier potassium channel 0.00016
Further Details:      
 
Domain Number 2 Region: 48-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.4e-21
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001378   Gene: ENSMGAG00000001874   Transcript: ENSMGAT00000002034
Sequence length 358
Comment pep:known_by_projection chromosome:UMD2:11:2482204:2484226:1 gene:ENSMGAG00000001874 transcript:ENSMGAT00000002034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKQGKYTIESNNTKSSAPLLTQRYLRMVTKDGHSTFQMDGAQGQGLAYLRDAWGILMDM
RWRWMMLVFSASFVIHWLVFAVLWYVLAEMNGDLELDHDSPPDNHTICVKYITSFTAAFS
FSLETQLTIGYGTMFPSGDCPSAIALLAIQMVLGLMLEAFITGAFVAKIARPKNRAFSIR
FTRCAIVTHTEGKPYLMFQVANTRSSPLTSVQISAILYQEQENGQLHQTSIDFHLDSITL
DECPFFTFPLTYYHSITPSSPLAALLQREAARHFELVVFLSAVQEGTGEMCQRRTSYLPS
EIMLYHRFAPVLARSAKGEYQIKMENFDKTIPELPAAADSMNPRRTAKEIRINGQHVD
Download sequence
Identical sequences G1MSR0
ENSMGAP00000001378 ENSMGAP00000001378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]