SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001419 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001419
Domain Number 1 Region: 1770-1944
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 2.04e-60
Family Sec63 N-terminal domain 0.0000000202
Further Details:      
 
Domain Number 2 Region: 1144-1435
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.88e-56
Family Tandem AAA-ATPase domain 0.00041
Further Details:      
 
Domain Number 3 Region: 940-1112
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 9.68e-53
Family Sec63 N-terminal domain 0.00064
Further Details:      
 
Domain Number 4 Region: 606-818
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.83e-48
Family Tandem AAA-ATPase domain 0.00084
Further Details:      
 
Domain Number 5 Region: 344-596
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.24e-44
Family Tandem AAA-ATPase domain 0.00021
Further Details:      
 
Domain Number 6 Region: 1445-1652
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-38
Family Tandem AAA-ATPase domain 0.001
Further Details:      
 
Domain Number 7 Region: 1945-2057
Classification Level Classification E-value
Superfamily E set domains 1.82e-32
Family Sec63 C-terminal domain-like 0.000000928
Further Details:      
 
Domain Number 8 Region: 1652-1753
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000462
Family RecQ helicase DNA-binding domain-like 0.074
Further Details:      
 
Domain Number 9 Region: 818-923
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000789
Family RecQ helicase DNA-binding domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001419   Gene: ENSMGAG00000001831   Transcript: ENSMGAT00000002079
Sequence length 2065
Comment pep:known_by_projection chromosome:UMD2:10:3030515:3047747:1 gene:ENSMGAG00000001831 transcript:ENSMGAT00000002079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRKRDEDRHDINKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPR
DILCGAADEVLAVLKNEKLRDKERRKEIDLLLGQTDDTRYHVLVNLGKKITDYGGDKEIQ
NMDDNIDETYGVNVQFESDEEEGDEDIYGEVRDEASDDDMEGDEAVVRCTLSANLVASGE
LMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLL
LGFNTFDFIKVLRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKE
DLIREERSRRERVRQSRMDTDLETMDLDQGGEALAPRQVLDLEDLVFAQGSHFMANKRCQ
LPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLVSVEKLPKYAQAGFEGFKTLNRIQSKLY
RAALESDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDEFKIIYIAPMRSLVQ
EMVGSFGKRLATYGINVAELTGDHQLCKEEISATQIIVCTPEKWDIITRGGERTYTQLVR
LVILDEIHLLHDDRGPVLESLVARAIRNIEMTQEDVRLVGLSATLPNYEDVATFLRVDPA
KGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQVLVFVHSRKE
TGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMT
RVDRTLVEDLFADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDIL
QMLGRAGRPQYDTKGEGILITSHGELQYYLSLLNQQLPIESQMVSKLPDMLNAETVLGNV
QNAKDAVNWLGYTYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTAALMLDKNNLV
KYDKKTGNFQVTELGRIASHYYITNETMQTYNQLLKPTLSEIELFRVFSLSSEFRNITVR
EEEKLELQKLLERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGR
LMRAIFEIVLNRGWAQLTDKTLNLCKMIDKRMWQSMCPLRQFKKLPEEVVKKIEKKNFPF
ERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKVELTIAPDFQW
DEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLVTFFVPVFEPLPPQYFIRV
VSDRWLSCETQLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNP
IQTQVFNTVYNSDDNVFVGAPTGSGKTICAEFAILRMLLQNSEGRCVYITPMEALAEQVF
MDWYEKFQERLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWKQRKNVQNVNL
FIVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATS
TFNFHPTVRPPLELHIQGFNISHTQTRLLSMAKPVYHAIMKHSPKKPIIVFVPSRKQTRL
TAINILTTCASDVQRHRFLHCAEKDLVPYLDKLNDNTLKETLVNGVGYLHEGLTAMERRV
VEQLFSSGAVQVMVASRSLCWGMNIAAHLVIIMDTQYYNGKIHAYVDYPIYDVLQMVGHA
NRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDA
VDYLTWTFLYRRMTQNPNYYNLQGVSHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVA
PLNLGMIAAYYYINYTTIELFSMSLNAKTKVRGLIEIISNAAEYENIPIRHHEDNLLRQL
AQKVPHKLTNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAIRLIQACVDVLS
SNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDE
DRNALLQLSDAQIADVARFCNRYPNIELSYEVVEKESIRSGGPVVVLVQLEREEEVTGPV
IAPLFPQKREEGWWVVIGDSKSNSLISIKRLTLQQKAKVKLDFVAPATGTHNYTLYFMSD
AYMGCDQEYKFSVDVKEAESDSESD
Download sequence
Identical sequences G1MSU1
ENSMGAP00000001419 ENSMGAP00000001419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]