SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001501 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001501
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-34
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001501   Gene: ENSMGAG00000001987   Transcript: ENSMGAT00000002163
Sequence length 184
Comment pep:known_by_projection chromosome:UMD2:Z:9561227:9565599:1 gene:ENSMGAG00000001987 transcript:ENSMGAT00000002163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFVTILKAKGTLKPAVMSTIFGPLESIYSASQVLSLHLERGNLGLGLENFCQKLELYGHY
AENFEQANKTLMEQLRKNKSFRRFKKLQETRPQFQGRKLEDLLPLPLQRLHQYKHFLRDL
LENTSPGSAEYQKLARTVKPISDVSQWVQDVVRKRENSLQLHRVQKLLKGQKIQVLTPGR
SYRR
Download sequence
Identical sequences G1MT06
ENSMGAP00000001501 ENSMGAP00000001501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]