SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001550 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001550
Domain Number 1 Region: 1456-1634
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-46
Family DBL homology domain (DH-domain) 0.0000243
Further Details:      
 
Domain Number 2 Region: 1644-1759
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-39
Family Pleckstrin-homology domain (PH domain) 0.0003
Further Details:      
 
Domain Number 3 Region: 703-845
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000017
Family CRAL/TRIO domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001550   Gene: ENSMGAG00000002010   Transcript: ENSMGAT00000002213
Sequence length 1801
Comment pep:novel chromosome:UMD2:13:1513561:1575766:1 gene:ENSMGAG00000002010 transcript:ENSMGAT00000002213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDPSSCWSWLATLSRLAPMQQATAATVLCQVFDVVEKTYRGDGLRYLIDFLIPAKHILQC
IQQDACVQYCGLLFRHEGWPLCIHEKIVVQLASIDWRILKPGDFYLQVVPYLKKSPRIVL
KCLAKDKHNVEEVVIPEVSYTSIFTLEWLSTINGERMGIALENCLLTTDDKIFRVPWDNV
VNPEFINKPKIIENNITTPETTGKPSLLCLPMDHAERSLPDLESQCVQEQNPNCNNLVVN
SPAPQLGEALVNGVCSSPVPEEDLQSDLEGEYVELAQVSLPRFGSQTGSLTQSLALSYLT
QPRTRVDASKESNKTTACEELSPEGQLLSGAPGSMGNSFPATAAPSCSAEDACAAEQEAC
SECSVDWQCALCGNGDVCAGDGVSCKAQMTGSTGNMELESDGSSINPGVEMLEQSPETNP
DASAEEEVMEERGELLTEHQREVTQMVKSKRSLLVSTRELKMPCCPKLHCQQRASRWQNS
QVAVDLCWVLTLKQKTRVSLEASNLERGLAGRGGEQKESTLAVQVFASCSRQNEEVSSDV
SEKHPKPQAAERGHAAHPWLLGRCVPSHQKRVAGGLRNVVIGKLFSEKSDSEAKVPGSVL
QCFPPQLLILSPRSHSHSQTELILCNLPAFNVKHLGCDFFGPVVPDPREAHTISSKRRAS
IQLVNKVWVRKVQHSKKPNYGNCCSYLSQISTTQYKEKVKSIQIRVGGVCVGSTRDKSGR
AVAIITTRNTAWLNPHCNTTELVRLLLYLHSIPRPECQALGLTVLVDARRCSPVPALFKA
FSILQDMDPHCIHGVLLLVERDLTFRMEKPAAGQFEILTSMKSLHKHIDSSQLPLELEGT
FPYCHRDWLSFRMKLEHLLQGCQGACAFLQGAIHKVESGKLPERAEEAAVLLRNYRQLMK
NVLEDARLVRLQLEGGALLARLRKEESCVTLTQDYRDALDAAGVLYNRVDEGVHRLVMAS
NKRIQELELVMEFEKVEECFKEVSSWIENVGRKKLKEMINLDDSLEMLLQAQKQFREFDL
VASEYCRRGQEALKKMDRWEDFSSVDVHSYRVKLQTYRDQLEEFCTQLDESRHRVCETVR
LYEFFDKSSSSLLETCRTFPNYCLSKLVAWKTFYGFSGYFLFFFHQHLHCRVGVTAVFVA
PSKLCDYRRLSGGSSSIQCSFLGARQRCVRQRNSCKSCLIRGNSGLANQMAAHRLEQSSL
TQRVTGERMGIEEYGESTSASQPGPRLRLSVDPSLSDARVCRQTGDDVVLVSLLSAANGS
QARLRVQCGTDKCNRVGDRVTANRRPSSSRFSSSHVQSGTDDSKPWLSNRNNLQSHTLRR
KKKKKIIKRSLADLREFGMVEKQREISRWVQLCRTQFAAGVRGENPRLDAGTTELLCCCC
SAEALLPSLDGAQHVSIRLTAGDEHQRQKADPVLLKVHTCSSGSQQAPGLEENQSSSLLP
SWSTYRTSRPAVPSCSKLRHIIDEMVTTEREYVRSLCYIIESYFPEMERLDLPQDLRGKR
SVIFGNLEKLYDFHSQYFLRELESCCNHPLRVSHCFLRHKDQFGMYALYSKNKPKSDSLL
ASHGNTFFKFKQVQLGDKMDLASYLLKPIQRMSKYALLLKDLIKECSEAQEQELGYLRAA
EEMVKFQLRHGNDLLAMDAIRDCDVNLKEQGQLVRQDEFAIWLGRRKCQRHVFLFEDLIL
FSKPKRIEGGFDVYIYKRSFKTADIGLTENSGDSGLRFEIWFRRRKSSDTYILQASSAET
KQAWTSDIAKILWQQAARNKEIRMQEMVSMGVGNKPFLDIKPSEAAINDRAIDYIMKGRG
G
Download sequence
Identical sequences G1MT47
ENSMGAP00000001550 ENSMGAP00000001550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]