SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001689 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001689
Domain Number 1 Region: 330-413
Classification Level Classification E-value
Superfamily DEATH domain 8.54e-20
Family DEATH domain, DD 0.0000987
Further Details:      
 
Domain Number 2 Region: 83-121
Classification Level Classification E-value
Superfamily TNF receptor-like 2.36e-17
Family TNF receptor-like 0.00024
Further Details:      
 
Domain Number 3 Region: 123-163
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000471
Family TNF receptor-like 0.00021
Further Details:      
 
Domain Number 4 Region: 30-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000226
Family TNF receptor-like 0.00014
Further Details:      
 
Domain Number 5 Region: 164-186
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000707
Family TNF receptor-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001689   Gene: ENSMGAG00000002136   Transcript: ENSMGAT00000002354
Sequence length 422
Comment pep:known_by_projection chromosome:UMD2:29:2634861:2646373:-1 gene:ENSMGAG00000002136 transcript:ENSMGAT00000002354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRMQLIPSSLLCLLTASFSGPTWGSKEKCLTEMYTTSGECCKACNLGEGVVQPCGVNQT
VCEPCLDSVTYSDTVSATEPCKPCTQCVGLHSMSAPCVESDDAVCRCAYGYFQDELSGSC
KECSICEVGFGLMFPCRDTQDTVCEECPEGTFSDEANFVDPCLPCTICEENEVMVKECTA
TSDAECRDLHPRWTTHTPSLAGSDSPEPITRDPFNTEGMATTLADIVTTVMGSSQPVVSR
GTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANNRPVNQTPSPEGEKLHSDS
GISVDSQSLHDQQPPNQSTQGPAPKGDGNLYASLPPSKQEEVEKLLSSSAEETWRQLAGE
LGYKEDLIDCFTREESPARALLADWSAKETATLDALLVALRKIQRGDIAESLYSESTATS
PV
Download sequence
Identical sequences G1MTF9
ENSMGAP00000001689 ENSMGAP00000001689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]