SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001708 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001708
Domain Number 1 Region: 152-346
Classification Level Classification E-value
Superfamily E set domains 1.59e-75
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000000354
Further Details:      
 
Domain Number 2 Region: 48-168
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.75e-21
Family Voltage-gated potassium channels 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001708   Gene: ENSMGAG00000002161   Transcript: ENSMGAT00000002373
Sequence length 476
Comment pep:known_by_projection chromosome:UMD2:29:2701266:2707314:-1 gene:ENSMGAG00000002161 transcript:ENSMGAT00000002373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVRRKFGDEYQAVGPAAAGGRRERQRFVDKNGRCNVQHGNLGGESSRYLSDLFTTLVD
LKWRWNLLIFLLTYTVAWLVMASMWWGIAYLRGDLHRAHDDTYSPCVANVYNFPSAFLFF
IETEATIGYGHRYITERCPEGIVLFLFQSLLGSIVDAFLIGCMFIKMSQPKKRAETLMFS
RAAVVSQRDGKLCLMFRVGNLRNSHMVSAQIRCKLIKSRQTPEGEFLPLDQCELDVGFGT
GADQLFLVSPLTICHEINSKSPFFCLSQRSLRSEQFEIVVILEGIVETTGMTCQARTSYT
EDEVLWGHRFLPVMSLEDGFFRVDYSQFHATFEVPTPPYSVKEQEENLSLSSSWNSPVDN
KTRKEKVCSLDCVDIAEEKNKLPFKLQKISSRKEDLPKRVLRMSSSNTGKTCSTGDLLNI
QEMSSISNGEDGDDRIQLKALRMNAEKMPKSMRALKMKLEDNLPAKLCKINSDHLP
Download sequence
Identical sequences G1MTH5
ENSMGAP00000001708 ENSMGAP00000001708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]