SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001776 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001776
Domain Number 1 Region: 2-273
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.66e-60
Family Pancreatic carboxypeptidases 0.00000153
Further Details:      
 
Domain Number 2 Region: 273-369
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.3e-22
Family Carboxypeptidase regulatory domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001776   Gene: ENSMGAG00000002224   Transcript: ENSMGAT00000002442
Sequence length 374
Comment pep:known_by_projection chromosome:UMD2:4:4551984:4565677:1 gene:ENSMGAG00000002224 transcript:ENSMGAT00000002442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPEFKYVGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIINLIHSTRIHIMPSLNPDGF
EKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKAVDQN
PKLAPETKGVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSCPDDAIFQSLA
RSYSSLNPAMSDPNRPPCRKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVE
LSCEKFPPEETLKGYWEDNKNSLINYIEQIHRGVKGFVKDLQGNPIANATISVEGISHDI
TSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVPFSPAVVVDFELESLSERKEEEKEE
LMEWWKMMSETLNF
Download sequence
Identical sequences G1MTM8
ENSMGAP00000001776 ENSMGAP00000001776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]