SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001828 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001828
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.28e-36
Family Frizzled cysteine-rich domain 0.00012
Further Details:      
 
Domain Number 2 Region: 120-243
Classification Level Classification E-value
Superfamily TIMP-like 1.37e-20
Family Netrin-like domain (NTR/C345C module) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001828   Gene: ENSMGAG00000002272   Transcript: ENSMGAT00000002497
Sequence length 250
Comment pep:known_by_projection chromosome:UMD2:24:2710165:2717361:-1 gene:ENSMGAG00000002272 transcript:ENSMGAT00000002497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRLCHSVGYDKMVLPNLLDHETMAEVKHQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDR
PVYPCRWLCEAVRDSCEPVMQFFGFFWPEMLKCDQFPQDDVCIAMTAPNATEVSRPKGTT
VCPPCDNEMKSEAIVEHLCASEFALKMTIKEVKKENGDKVIIPRKRKALKLGPIRKKNLK
KLVLLLKNGADCPCHQLDNLGHHFLIMGRQVKTQHLLTAIYKWDKKNKEFKKFMKKVKAP
DCPTFPSVFK
Download sequence
Identical sequences G1MTR6
ENSMGAP00000001828 ENSMGAP00000001828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]