SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001831 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001831
Domain Number 1 Region: 250-572
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-88
Family Protein kinases, catalytic subunit 0.0000000972
Further Details:      
 
Domain Number 2 Region: 14-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.14e-28
Family PB1 domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 113-183
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.04e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001831   Gene: ENSMGAG00000002228   Transcript: ENSMGAT00000002500
Sequence length 592
Comment pep:known_by_projection chromosome:UMD2:23:1837424:1876422:-1 gene:ENSMGAG00000002228 transcript:ENSMGAT00000002500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSRMGSKGNLNKDIIRVKAHYSGDILITNLDASISYEELCDEVREMCNLQQEQPITLKW
IDDEGDPCTISSQMELEEAFRLYCQNREEGLIIHVFPSIPEKPGMPCPGEDKSIYRRGAR
RWRKLYRVNGHLFQAKRFNRRAYCGQCSERIWGLSRQGYKCINCKLLVHKRCHILVPLTC
KRHMDSVMPSQEPQLGDKNDEVDLPSEENDGIPYIPSNRKHDSIKDDSEDIKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDAEGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCQPQTGFSDIKSHTFFRSIDWDLLEKKQTTPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDIIKRIDQSEFEGFEYINPLLLSTEETV
Download sequence
Identical sequences G1MTR8
ENSMGAP00000001831 ENSMGAP00000001831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]