SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001850 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001850
Domain Number 1 Region: 368-556
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.2e-66
Family Regulator of G-protein signaling, RGS 0.00000805
Further Details:      
 
Domain Number 2 Region: 764-992
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-63
Family DBL homology domain (DH-domain) 0.0000000025
Further Details:      
 
Domain Number 3 Region: 993-1128
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-42
Family Pleckstrin-homology domain (PH domain) 0.0000022
Further Details:      
 
Domain Number 4 Region: 70-149
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-22
Family PDZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001850   Gene: ENSMGAG00000002234   Transcript: ENSMGAT00000002519
Sequence length 1544
Comment pep:known_by_projection chromosome:UMD2:26:3912119:3951059:-1 gene:ENSMGAG00000002234 transcript:ENSMGAT00000002519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLYLLFLLFRFPLKKPTRHGSILSRESPADKKQKVERCSSTHDFDPTDSSSKKTKSSSE
ESRSETYGLVQRCVVIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNG
TLVTHSNHLEVVKLIKSGSYVALTVQGRPPGSPQIPLADSEVDLAAFGHMSPIMTSPHSP
GTSGNAERITSPVLMGEENNIVHNQKVEILRKMLQKEQERLQSLQEEYSRSASSRLLREI
QETKKHITQLQEQLSKATGCAQDGVLSSRSVAESLQVSEVEAESGDALSKLDYSSDSPSR
PNSDIADSPRSGLKERVYLDESPEKTELQDTDSQSSIGSPSSRVGPQIIGAEDDDFDTEQ
EQINGQCSCFQNIELLKSRPAHLAVLLHHVVSQFDPAALLCYLYTDLYKQTNAKETRRVF
LEFYQFFLDRAANLKVPIPDEISVDLEKRRPELIPEELHRHYIQTMQDKVCPEVQRNLED
FRQKRSMGLTLAEGELTKLDAERVRDRNAVEKERACAEQIIAKIEEVLMTSQPLEEDKSS
TIQYVILTYMKHLGVKAKETRNLEQKRGRIGFLPKIKQSIKKEKEGDEKGKRRGFPNLLG
PPRRPSRHDSSAIGRAMEIQKQRHQKHIPAVPSVSPEPPDSGKVRQSGSSSDGTDAPYPP
ANPMSPLAVGPFSSPEGNKDSESGSKQTGEAPPANECVDGTPRTPNTTFEFPSPLENLPE
EEGESERVVDMGTPKPFRKMDSVGFADVQSEDELYDFDMDTDPPNWQQLVSREVLMGLKP
YEIKRQEVINELFYTERAHVRTLKVLHNVFYQRVTREGILSSSDKRKIFSNLEDILGLHV
ALNDQMKAVRKRNETSVIDQIGEDLLSWFSGAAEEKLKHATATFCSNQPFALEVIKSRQK
KDSRFQTFVQDAESNPLCRRLQLKDIIPTEMQRLTKYPLLLDNIAKYTELPEEKEKVKKA
ADHCRQVLNHVNQAVKESENKQHLEDYQRRLDLSYLKQSEDPMMDEFRNLDLTKRKMLHE
GPLTWKVNRDKTIDLYTLLLEDILVLLQKQDDKLVLKCHSKILASTADSKHTFSPIIKLN
TVLVRQVATDNKAFFVISMSENGAHIYELVAQTVSEKNVWQDLIAQMAGNVKMESSRRVI
PLPQSGPGEEEREEEEQQKLKDQHDIPASSLQSPDKDLGLDSPLILNAQTSPTMSEKSEV
ESLLVAERQFDKVQQADLALKESSPCYEHTASNLPLVSGGQWALDALRNLDLLKKLLVQQ
LGFAEKGTLEDRQRFPRFRTVSQEAQTESGSELGLQHSDHNKFHQPGTDPTLPRSGTNEP
TANYGLRTSAESPAPGDAMQLGARDPRPSSNLAMDRVGVNLEVSATELEGMGADESGEHF
FDAREAHSDENPSESELMERKDEEDVQIRISGNYLILDGYEAVQESSTDEEVSSLVLQGA
AGGHTSLDSAQQQPLSPRDTQSEGGSSPFAEEMMVSRWGGVEEPCTVVANPPFWSIEARV
QMMQYIQKIENDLEKLKEVEEDYIILRRQGLAGSASTGEHSGMT
Download sequence
Identical sequences G1MTT6
ENSMGAP00000001850 ENSMGAP00000001850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]