SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001910 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001910
Domain Number 1 Region: 108-271
Classification Level Classification E-value
Superfamily E set domains 2.52e-17
Family Arrestin/Vps26-like 0.08
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily E set domains 0.000000000000469
Family Arrestin/Vps26-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001910   Gene: ENSMGAG00000002332   Transcript: ENSMGAT00000002581
Sequence length 382
Comment pep:known_by_projection chromosome:UMD2:19:1909909:1922452:1 gene:ENSMGAG00000002332 transcript:ENSMGAT00000002581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIKVSCVGFCGVSNKINDTAWTVEEQYFNSTLSLADKGVLSPGEHNFSFQFLLPASAPTS
FEGPFGKVLHQVKAVIDTPRFSKDYKCNKIFYVLCPLNLNDILDIEQPNTMSVTKKFNYK
LVKSGNVVLTATSDLKGYIVGQVIQLRTDIENKSGRDTGAVVASLLQKVAYKSKRWIYDL
RTIAEVEGSGVKAWKHAEWKEQILVPALPQSILQGCSLIHIDYYIQVSLKSPEVSVTLPI
YIGNIAVNRVPLSPSRSVQHLPSAVVPSAPPEEEEAAGGYHPMDNVLIPTKSHSQQQPFS
YAPGLSFQEADSEQTGSPNHPTLCLSTGATIPYYAEGNVVPVPTASSLILPPEYSTWGYP
YEAPPSYEQSCSSANSSISNGN
Download sequence
Identical sequences G1MTX5
ENSMGAP00000001910 ENSMGAP00000001910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]