SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001940 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001940
Domain Number 1 Region: 23-143
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.15e-45
Family Frizzled cysteine-rich domain 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001940   Gene: ENSMGAG00000002379   Transcript: ENSMGAT00000002611
Sequence length 572
Comment pep:known_by_projection chromosome:UMD2:17:3416952:3532282:-1 gene:ENSMGAG00000002379 transcript:ENSMGAT00000002611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLCWLAERCAGISSIDIERPGDGRCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLH
EFAPLVEYGCHSHLKFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWP
DSLDCSKLPNKNDPNYLCMEAPNNGSDEPPRGSSMLPPMFRPQRPSSGHDLQQHKDSLSR
TSCENPGKFHHVEKSASCAPLCTPGVDVYWSKDDKQFAVIWIAIWSILCFFSSAFTVLTF
LIDPQRFKYPERPIIFLSMCYCVYSVGYIIRLFSGAESIACDRDSGQLYVIQEGLESTGC
TIVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMI
LVMRRVAGDELTGLCYVGSMDVNALTGFVLIPLACYLIIGTSFILSGFVALFHIRRVMKT
GGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMDYWKIVATQQKCKMNNQTKN
LDCMMNNSIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRLKKRSRRKPAS
VITSSGIYKKPQHPQKTHLAKYESTLQPPTCV
Download sequence
Identical sequences G1MTZ7
ENSMGAP00000001940 ENSMGAP00000001940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]