SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000001957 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000001957
Domain Number 1 Region: 132-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 350-428
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00000000000000116
Family Frizzled cysteine-rich domain 0.0011
Further Details:      
 
Domain Number 3 Region: 248-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000001957   Gene: ENSMGAG00000002384   Transcript: ENSMGAT00000002628
Sequence length 430
Comment pep:novel chromosome:UMD2:26:4423442:4425960:1 gene:ENSMGAG00000002384 transcript:ENSMGAT00000002628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDFTEITLCPEALERSETEFCNPVFEGEEPLAVPPAEQPPDDDGLWVQAGWQYRADCRF
TWLCVALMSAVLLFLIALLLGIVIHQLTSPPPPHSPAAALPARSTATTTVAPSQRDPQDP
QTLHPNPWPTTSCGGTLRGPEGSFSSPNHPGPYPPHALCIWHIEVAAGMAIQLTMDAFSV
EGTASCLFDRLELYEEQGARGGTARFCGSVVPPTFNSISNHLRVTFVSDGSVGAPGFSAR
YRAVAPSESEYIICGNGECRALESVCDGWHDCPDGTDELNCTGVSYPAFAIPQPPPTQAP
SASRWRWRCAWGWVTMPPPSLTSGWPSQTRRELPRCCKTIRVGALHHTVLTASLLQTLME
LACYQHLRLLICSLFVPKCTPDGGVLQPCRAVCLAAELRCQHSLGLLGILWPINCNILPD
SNDPVECFQP
Download sequence
Identical sequences G1MU09
ENSMGAP00000001957 ENSMGAP00000001957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]