SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002205 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002205
Domain Number 1 Region: 10-117
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-39
Family Pleckstrin-homology domain (PH domain) 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002205   Gene: ENSMGAG00000002604   Transcript: ENSMGAT00000002880
Sequence length 177
Comment pep:known_by_projection chromosome:UMD2:29:3455242:3459550:1 gene:ENSMGAG00000002604 transcript:ENSMGAT00000002880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMEEITMRPVEDTGNVLKQGYLEKRSRDHSFFGSEWQKRWCVLHRKTFYYYANEKSKQPK
GTFSIEHYSARLAFHLRKDSRRRCCFELVCPGKRTYEFTAPSPAEAEDWVDQIQFLLKAD
LSSLTIPYDEEEEELYNDVGSSDSTTTTSHNTTLNQDDGMEEDDIYEVFPGKRQNDE
Download sequence
Identical sequences G1MUJ0
ENSMGAP00000002205 ENSMGAP00000002205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]