SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002271 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002271
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.09e-78
Family BAR domain 0.0000000157
Further Details:      
 
Domain Number 2 Region: 289-370
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002271   Gene: ENSMGAG00000002570   Transcript: ENSMGAT00000002946
Sequence length 374
Comment pep:known_by_projection chromosome:UMD2:30:2029590:2037870:-1 gene:ENSMGAG00000002570 transcript:ENSMGAT00000002946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLSELSSVLAAASRLVSEKVGGAEGTKLDDDFKEMEKKVDLTSKAVTEVLTRTIEYLQP
NPASRAKLTMLNTMSKIRGQVKNPGYPQSEGLLGESMIRYGKELGEDSNFVEGDALLDAG
ESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKI
PDEELRQAMEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELAE
KLKTQSARMREASSRPRREYKPKPRETYDFGESDQSNGGFSCTPTPKVSEAASSSFRSDK
PSRASVRSIPHLDQPCCKALYDFEPENDGELGFKEGDIITLTNQIDENWYEGMINGQSGF
FPLNYVEVLVPLPQ
Download sequence
Identical sequences G1MUP0
ENSMGAP00000002271 ENSMGAP00000002271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]