SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002328 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002328
Domain Number 1 Region: 680-939
Classification Level Classification E-value
Superfamily VPS9 domain 1.14e-41
Family VPS9 domain 0.0051
Further Details:      
 
Domain Number 2 Region: 431-560
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.14e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0072
Further Details:      
 
Domain Number 3 Region: 357-446
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 9.02e-16
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.019
Further Details:      
 
Domain Number 4 Region: 8-204
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000086
Family DBL homology domain (DH-domain) 0.0052
Further Details:      
 
Domain Number 5 Region: 253-324
Classification Level Classification E-value
Superfamily PH domain-like 0.00000249
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002328   Gene: ENSMGAG00000002690   Transcript: ENSMGAT00000003004
Sequence length 950
Comment pep:known_by_projection chromosome:UMD2:6:2702116:2727723:-1 gene:ENSMGAG00000002690 transcript:ENSMGAT00000003004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAAEATSSLLQVEENFSACLARMDALIFKPLLQSGREPSDQKGKENFKLFLLLNDQFQA
LWNLTEENYRIVKEKCSTSESFCIQDIYIVWKGDLFLSLYIRYFVTFANYVVVHGFEHAT
KSKSEAWKHHKTVLKQFLTDFTSETSMSLALYTVLHKPIRDHVEQYILLLNKLNEVLKEQ
SSEKDIVNSAVKEYVKLKSFISQVLDEACFTKTLWKSLGYKFTDMLCVPERRLLEDSKNL
PISASTNRSDRILLFDDVLVLIQGNSFQSFDLKLVWVDETCRYGLRIITPEETFVLTAKD
PQMKAVWQWKLNQAIRQALNGKRDFPLWGKTGEGTEPSSYRFFTYVFRLESKFKSASYEG
EWHWGKPHGKGTLKWRDGRNHVGDFKEGLEHGFGICLVPRRSEDRYDCYKCHWYEGKMRG
YGICEYGNDMVYKGYFKDDVRQGFGILENFSAEHPFKYTGQWENDKKNGYGVWEDKDRGE
RYIGTWLDDHRHGQGIVVTQSGVCYQRTFHADKMVMKGSGILLLEDDSVYEGNFTQDLTF
VGKGKLSFANGFILEGTFTNKSGQGLQTQGILNTSNEQLDERITKAQLGLKEFPVEKRWK
GIYDQFLEFIHSGCKEEMEESFTGFHIQTSKELRKSQEYLFCQRGSEDVSWKTEDILEEL
VQHHELGSLQSYLEKALKSSLHPLGKLLKALTIAFQATYSGIGANRHLLTMAQEEVKYYA
KKIWEFYQGLLHLALEQKGQLPVKCVDGEVSDQKAYSVVLPLILPCFYPELFMLYMLYHE
REDDLYCQGIVDLSLFPDIKLLEFLDVQKHLWPLKDLTLTTNQRRSLIKDKCFLSATECL
QKLITTVDPREKLLILQKTYEEIESTVSRVVEKDYKLPMDDLLPLLMYVVSRAKIQHLGA
EIHLIRDLMDPTNQGGLYDFLLTALESCYEHIQKMRLHQRISHLHLENAG
Download sequence
Identical sequences G1MUT5
ENSMGAP00000002328 ENSMGAP00000002328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]