SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002402 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002402
Domain Number 1 Region: 424-688
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-76
Family Protein kinases, catalytic subunit 0.0000000107
Further Details:      
 
Domain Number 2 Region: 13-104
Classification Level Classification E-value
Superfamily E set domains 0.0000000000012
Family Other IPT/TIG domains 0.042
Further Details:      
 
Domain Number 3 Region: 102-196
Classification Level Classification E-value
Superfamily E set domains 0.0000000448
Family E-set domains of sugar-utilizing enzymes 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002402   Gene: ENSMGAG00000002710   Transcript: ENSMGAT00000003079
Sequence length 729
Comment pep:known_by_projection chromosome:UMD2:14:2638727:2642156:-1 gene:ENSMGAG00000002710 transcript:ENSMGAT00000003079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVQGSTALSGFIFVEPRISILHPSFGPQGGGTLMSLRGTHLSAGSSWRVTINGSECPLDG
QPSQGNGEIQCTTPAASSLGAAPVALWIDGEEFLAPLPFEYRPDPSVLAIVPNCSYGGSM
LTLIGTHLDSVYRAKIQFEGGGGGKTEATECEGPQSPDWLLCCSPAFPVETKPVPGNLSV
LLDGAAGRWLFRLRYFPRPQMFPFGQQGERYQLKPGDNEVKVNQLGLDSLAGCMNITMTV
GGRDCHPNVLKNEVTCRVPRDVDLSPAGPLCRICVNGACQALGLVLSASSLDMAASLALG
TGVTFLVCCILAAVLLRWRWRKRRGTENLELLVHSARSEHPITIQHPNVDYREVPVLPVA
DSPGLARPHAHFAGAGAGADAAGGGSPVPLLRTTSCCLEDLRPELLEEVKDILIPEERLI
THRSRVIGRGHFGSVYHGTYMDPLLGNLHCAVKSLHRITDLEEVEEFLREGILMKSFHHP
QVLSLLGVCLPRHGLPLVVLPYMRHGDLRHFIRAQERSPTVKELIGFGLQVALGMEYLAQ
KKFVHRDLAARNCMLDETLTVKVADFGLARDVFGKEYYSIRQHRHAKLPVKWMALESLQT
QKFTTKSDVWSFGVLMWELLTRGASPYPEVDPYDMARYLLRGRRLPQPQPCPDTLYGVML
SCWAPTPEERPSFSGLVCELKRVLASLEGERYVNLAVTYVNLESSPPFPRGQLPDSEDEE
DEEDEEDEE
Download sequence
Identical sequences G1MUY8
ENSMGAP00000002402 ENSMGAP00000002402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]