SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002694 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002694
Domain Number 1 Region: 18-115
Classification Level Classification E-value
Superfamily DEATH domain 1.6e-20
Family Caspase recruitment domain, CARD 0.015
Further Details:      
 
Domain Number 2 Region: 1016-1156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000212
Family Nucleotide and nucleoside kinases 0.0032
Further Details:      
 
Domain Number 3 Region: 684-768
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000945
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002694   Gene: ENSMGAG00000002976   Transcript: ENSMGAT00000003376
Sequence length 1161
Comment pep:known_by_projection chromosome:UMD2:16:3639908:3661160:-1 gene:ENSMGAG00000002976 transcript:ENSMGAT00000003376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGEPEMDDCLETLKDEEEALWENVECNRHMLSRYINPAKLTPYLRQCKVIDEQDEDEVLN
SLMLPSKINRAGRLLDILHTKGQRGYVVFLESLEFYYPELYKLVTGKEPTRRFSTIVVEE
GHEGLTHFLMNEIIKLQQQVKTKDMQRCDLLAKSRQLEDERKQLKLNKIELMTFQERYNK
MKEERNNYSDELVKVKDENYNLAMRYAQLSDEKSMAVMRSRDLQLEIDQLKHRLNKVEEE
CKLERNQSLKLKNDIENRPKKEQMLELERENEMMKTKIQELQSIIQADKRSLPDSDKAIL
DILEHDRKEALEDRHELVNKIFNLQEEIRHVEDLRDKYLEEKEDLELKCSTLGKDCEMYK
HRMNTVMIQLEEVEKERDQAFRSRDEAQTQYSHCLIEKDKYRKQIRELEERNDELRIEMV
RKEACIVNLECKLRRLSKDNNCHDQSLPRNLPITIISQTFGTSSPKANGQEADDSSTSED
SPEDNKFFLPDQARLKRRVNLKGIQINPRAKSPVSMNRTSEFQVRAQDEDGADASNGRTD
NSSSNSVSISNSISSCEQTLRNRNDSIMSTTPEPPGNDSIVRRCKEDAPPCRSEKNSSNH
YNKDQLHFSDDSHDRHSHGAPSVHSSSSSHQSEGLDAYDLEHVNSIFRKFSLERPFRPSV
TSVGRIRNSCHTIQRITLNGDTLNSEITLIGGNDKGSFVSSVKSGSLAEKAGLREGHQLL
LLEGCIKGENQSVPLDTCTKEEVHWTIQRCHGPVTLQYKSNHEGYRKLLSELEDGLIASG
DSFHIRLNLNISSQLDCCSLSVKCDEIVHILDTMYQGTCGGCDWLCARVDPFTDKDLERG
TIPSYSRAQQLLLVKLQRLMHRGSKDETDSSHNTLRALRNTLQPEEPAPQSDPKTSPRLS
RASFLLGQILQFVSRSENKYKRMNSNERVRIVTGWPSGLARTSSEAKKPLPDKLEDLDSK
SEINKRLIPYSLVRPIHCERRRPVLFTPTVLAKSLVQKLLNSGGALEFNICKPDIVTKEE
LLRRQRTETIIFSREKNLSTYECIVPANIEAVTAKNKHCLLEAGISCTKDLIKAKIYPIV
LFIRVSEKNIKRFRKLLPKPEAEDEFLRMCRLKEKELEELPCLYASVEADTWSSIEDLIR
TIKDKIGEEQRKTIWIDEDQL
Download sequence
Identical sequences G1MVL0
ENSMGAP00000002694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]