SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002729 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002729
Domain Number 1 Region: 21-206
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-59
Family Phosphotyrosine-binding domain (PTB) 0.000000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002729   Gene: ENSMGAG00000013112   Transcript: ENSMGAT00000003412
Sequence length 218
Comment pep:known_by_projection chromosome:UMD2:30:2198984:2201726:-1 gene:ENSMGAG00000013112 transcript:ENSMGAT00000003412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAMGICRQMGTPWCHGTMRSTXDEWNRKGSFINKPAQGWLHPDERVLGPGVSYIVRYMGC
IEVLRSMRSLDFNTRTQVTREAINRLYEAVPGVKGIWKKKAPSKALFSILGKSNLRFAGM
SIAVNISIDGLNLMIPTTRQIIANHHMQSISFASGGDMDTTDYVAYVAKDPINQRACHIL
ECCDGLAQSVINTVGQAFELRFKQYLHSPPKAVVPPDR
Download sequence
Identical sequences G1MVN6
ENSMGAP00000002729 ENSMGAP00000002729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]