SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002792 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002792
Domain Number 1 Region: 220-413
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 1-209
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.45e-49
Family BAR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002792   Gene: ENSMGAG00000003110   Transcript: ENSMGAT00000003479
Sequence length 415
Comment pep:known_by_projection chromosome:UMD2:20:2127608:2134264:-1 gene:ENSMGAG00000003110 transcript:ENSMGAT00000003479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAEKTEVLSEDLLQVEKRLELVKQVSHSTHKKLTACLQGQQGVDADKRSKKLPLTCVPCR
KMLRLCGEAEDKLAQELIQFELQVERDVIEPLFVLAEVEIPNIQKQRKHLAKLVLDMDSS
RTRWQQSAKSSGLSSNLQPSGAKADALREEMEEAANRVEICRDQLSADMYSFVAKEIDYA
NYFQTLIEVQAEYHRKSLALLQSVLPQIKAQQEAWMEKPSFGKPLEEHLAVSGREIAFPV
EACVTMLLECGMQEEGLFRVAPSASKLKKLKAALDCCVVDVQEYSADPHAIAGALKSYLR
ELPEPLMTFELYEEWIQASNIPEQEKRLQALWNACEKLPKANYNNIRYLIKFLAKLTEYQ
DMNKMTPSNVAIVLGPNLLWPQAEGNITEMMTTVSLQIVGIIEPLIQHADWFFPG
Download sequence
Identical sequences G1MVU2
ENSMGAP00000002792 ENSMGAP00000002792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]