SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002803 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002803
Domain Number 1 Region: 589-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-41
Family Protein kinases, catalytic subunit 0.00025
Further Details:      
 
Domain Number 2 Region: 836-1011
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-35
Family Protein kinases, catalytic subunit 0.00064
Further Details:      
 
Domain Number 3 Region: 388-495
Classification Level Classification E-value
Superfamily SH2 domain 0.000000152
Family SH2 domain 0.01
Further Details:      
 
Domain Number 4 Region: 329-393
Classification Level Classification E-value
Superfamily PH domain-like 0.000000504
Family Third domain of FERM 0.041
Further Details:      
 
Domain Number 5 Region: 104-230
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000586
Family Second domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002803   Gene: ENSMGAG00000003029   Transcript: ENSMGAT00000003490
Sequence length 1025
Comment pep:known_by_projection chromosome:UMD2:18:234418:244176:-1 gene:ENSMGAG00000003029 transcript:ENSMGAT00000003490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEEQWWSDGSRAPSAEEICVELARRLGISPRCAALFALYDAPSRTWLPPNHRFGAMEDRD
RRLHFRIRFYFRNWHGMNEAEPAVFRHAPRHNEGTGEKPRGTAVLDRASFQYLFEQGKFD
FINDAASLTDFQSEQEVQRFKNESLGMAVLHLCHIALRGGRCLEEVARKYSFKACIPRSF
RLQIQQSSAVTRLRMKNVFRKFVRRFQRHTVGAGTLTEEDVMFKYLATLELLAPRFGTER
FAVLSLDVSNEGEKAQPCGNGGHEMAERGDAAAPGDSSVSHEVLVSGTTGIQWRPVPSEQ
SVEVISHRGYFGRRSRRKDPEPPAPPEPPWVHFCDFQEITHIVVQDCRVCVHRQDNKCME
VLLPSHPSALSFISLLDGYFRLTADSNHYLCHDVAPPRLVMSILNGIHGPMQEEFVFAKL
RQEEHEEGLYVLRWSVLDFDRVILAVAKRDPAVPGGLQFRQFRIQKKGSSFVLEGWEREF
PTVRALLDALQGCTLRSGEDSFTVKRCCLPKPGEISDLLITTQKVKDNAKRILNLTQLSF
HQIRKDEITQPQRAHLGQGTRTNIYDGVLNVRGAAGPDEAEYFSTEQNNNSDGREMHVVL
KVLDPTHRDIALAFFETASLMSQVSHVHLAFVHGVCVRGSENIMVEEFVEHGPLDVLLRK
EKGRVPVGWKITVAKQLASALSYLEDKSLVHGNVCAKNVLLARTGLGDGTQPFVKLSDPG
VSFTALTREERVDRIPWIAPECIQDVGNLHPAADKWSFGTTLLEICFDADVPLKERTPAE
KERFYEKKHRLPEPSCQDLAALIQQCLSYAPAERPSFRTVLRDLTQLQPHSLMDVSSVNP
DLTVSDPTVFQKRYLKKIRELGEGHFGKVGLYCYDPTNDGTGEMVAVKSLKAGCSPQLLA
SWKKEIAILKTLYHENIVKYKGCCSEQGMVGTPWGRPQQQLGGAEKGIWGVSMVEFWDVS
QNIVGGMAYLHSLHYIHRDLAARNVLLESDRRVKIGDFGLAKALPHGCDYYRVRDDGDSP
VFWWA
Download sequence
Identical sequences G1MVV3
ENSMGAP00000002803 ENSMGAP00000002803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]