SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002822 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002822
Domain Number 1 Region: 115-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.3e-111
Family Pancreatic carboxypeptidases 0.0000000276
Further Details:      
 
Domain Number 2 Region: 19-110
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 7.44e-26
Family Pancreatic carboxypeptidase, activation domain 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002822   Gene: ENSMGAG00000003148   Transcript: ENSMGAT00000003509
Sequence length 419
Comment pep:known_by_projection chromosome:UMD2:1:1069391:1073000:1 gene:ENSMGAG00000003148 transcript:ENSMGAT00000003509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLLLAALGAVAAATTENFVGHQVLRIVPSSDAELQKVQELQELEHLQLDFWLSPRGL
GDPVDIRVPFPSLQPLKAHLEASGVPYSIMIEDVQALVDLEQMQMLRRRRFVPFSTSTFD
YTSYHTLNEIYAFMDLLVAENPNLVSKLEIGHTTENRPIYVLKFSKGGTNRPAIWIDTGI
HSREWVTQASGVWFAKKIVQEKDEGLANILDQMDIFLEIVTNPDGFVFTHTSNRMWRKTR
SRHSGSLCVGVDPNRNWDAGFGGSGASGNPCSETYRGPYANSEPEVQAIVDFVKNHGNIK
AFISIHSYSQLLLYPYGYTTTAVPDKEELHQVAKEAVAALSSLYGTNYKYGSIITTIYQA
SGGTIDWTYNQGIKYSFTFELRDTGRYGFLLPASQIVPTAEETWKALEVIMAHTRGHLY
Download sequence
Identical sequences G1MVW5
ENSMGAP00000002822 XP_010706545.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]