SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002860 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000002860
Domain Number - Region: 199-235
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0222
Family Frizzled cysteine-rich domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002860   Gene: ENSMGAG00000003133   Transcript: ENSMGAT00000003548
Sequence length 505
Comment pep:known_by_projection chromosome:UMD2:9:3311830:3347223:-1 gene:ENSMGAG00000003133 transcript:ENSMGAT00000003548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDHLKVCSQAYTCCTQEMEERYSQLSKHDFRNAVVELSNHLQTMFSSRYKKFDEFFKELL
ENAEKSLNDMFVRTYGRLYMQNSELFKDLFVELKRYYVGGNVNLEEMLNDFWARLLERMF
RLVNPQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVARDVVS
KVSAVNPTPQGTQALLKMMYCPHCRGLISVKPCYNYCFNVMRGCLANQGDLDTEWNIFMG
SMLLVAERLEGPFNIESVMDPIDVKISDAIMNMQENSMQVSQKVFQGCGQPKTLAQGRTA
RSVSEGGFSARFRPYNPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPGNICSDEKI
SVGTGNENECWNGSAKSRYDFAVTGNGLASQVNNPEVEVDITKPDMVIRRQIMVLRVMTN
KLKNAYSGNDVDFIDVSEESSGEESGSGCEFQQCSTEFEFNATEVTGNSNKSDKKVNTSA
APSSGLSQAALFLSILVLAMQRQWR
Download sequence
Identical sequences G1MVZ0
ENSMGAP00000002860 ENSMGAP00000002860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]