SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000002865 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000002865
Domain Number 1 Region: 18-200,369-457
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.57e-45
Family Bacterial dinuclear zinc exopeptidases 0.0013
Further Details:      
 
Domain Number 2 Region: 212-259,305-352
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000613
Family Bacterial exopeptidase dimerisation domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000002865   Gene: ENSMGAG00000003150   Transcript: ENSMGAT00000003553
Sequence length 473
Comment pep:known_by_projection chromosome:UMD2:28:2275164:2285646:-1 gene:ENSMGAG00000003150 transcript:ENSMGAT00000003553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWARRGGTAAFSIEERLEMKETLRGAVKIPTVSVSPEDLNATAMAEFGDYIQKVFPAVFS
SKFIQHEIVGEYSHLFTVQGSDSEMMPYMLLAHMDVVPAPLEGWDFPPFSAAEHEGFIYG
RGTLDNKNSAIGILQALEFLLRRNYRPRRSFYVGIGHDEEVFGRKGAVKIAALLESRGVK
LSFLLDEGSAILDGIIAGMKKPVALIAVTEKGSITLNFTVEKEPGHSSFPPKETSIGILA
TAMSRLEQNPMRNLFGHGPELMTMEHLASEFNFPLNLIMSNLWLFSPIVSRVLAWKPSTN
ALIRTTTAVTMFNAGIKLNVIPSSARATVNFRIHSAEKAREVLETVRNTIADDRVKIDVV
EAFDPLPISPWDDQTFGVHVFQRTILDTFPNVDSVVPGTCIGNTDSRHFTNVTDAIYRFN
PVLLKSDDLPRIHGLNERISVESYEKQVEFLFQLIKNCDVDELPEPHANSHEL
Download sequence
Identical sequences G1MVZ3
ENSMGAP00000002865 ENSMGAP00000002865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]