SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003039 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003039
Domain Number 1 Region: 176-313
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-24
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 2 Region: 416-505
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-20
Family Pleckstrin-homology domain (PH domain) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003039   Gene: ENSMGAG00000003323   Transcript: ENSMGAT00000003732
Sequence length 767
Comment pep:known_by_projection chromosome:UMD2:15:8122575:8129730:-1 gene:ENSMGAG00000003323 transcript:ENSMGAT00000003732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSVLDQLLPELSILLKLLDHEYLSATAQEKKVAVSSILQKLQPPTGKDTDFMYVNTASLS
NGTSFVESLFEEFDCDLRDLRDMQEDDGDTGDSIGVELARSQPAKSVPADPPPPLPTTPP
PEDYYEEALPLGPGKAPEYITSRNSSSPPNSVMDGYYEDADSNYPVTRMNGEQKNSYNDS
DAMSSSYESYDEEEEEGKGQQLTHQWPSEEASMNLVKDCRICAFLLRKKRFGQWAKQLTI
IRDGKLLCYKSSKDRQPHVEVPLSTCNVIYVPKDGRRKKHELRFSLPGAEALVLAVQSKE
QAEEWLKVIKEASTAGTSGMEIPMSPVMPCKMDLDKRLSQEKHTSDSDSVATGETCSPMA
RRELCENGKVKKSGLADLKGSMSRAAGKKITRIISFSKKKPSPEDTQTSSTEEDIPCCGY
LSVLVNQCWKERWCRLKANTLYFHKDRTDLRTHVNAINLRGCEVVPGLGPKHPFAFRILR
NGQEVAALEASCSEDLGRWLGLLLVETGSQTAPEALHYDYVDVETIANIVTAVRHSYLWA
SSSQDSRPDSSRVVYDDVPYEKVQAEEESGRPAGAQVKRHASSCSEKSRRIDPQVKVKRH
ASNANQYRYGKNRAEEDARRFLTEKDKLEKEKAAIRSELVLLRKERRELREAMKSSSGVK
LQDLEQRVALLEEQCRQKEERRVDLELQLSEVKEQLKQSLAGGPALGLAVTSKAENGEAT
NKPNGSPPEHLVPVNSAAELRKRSPSILPANKGNVLRKAKEWEKKQT
Download sequence
Identical sequences G1MWC5
ENSMGAP00000003039 ENSMGAP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]