SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003054 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003054
Domain Number 1 Region: 88-176
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000377
Family Pre-dockerin domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSMGAP00000003054
Domain Number - Region: 272-329
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000981
Family Carboxypeptidase regulatory domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003054   Gene: ENSMGAG00000003363   Transcript: ENSMGAT00000003748
Sequence length 835
Comment pep:known_by_projection scaffold:UMD2:GL424615.1:7:2772:1 gene:ENSMGAG00000003363 transcript:ENSMGAT00000003748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPEHTLQGAVVSATGAALPGARVYLEGRPPALLARSDTRGAFRVTGLCVNIGANVSAHRD
GFAPGLAPVVSNGTGLLVAHIVLQKLEKPYMVLHPTPKVRVAGQEVTFCCKASGTPVPKK
YYWYHNGTLLDRTAHRYSSRLVLRALRPEQAGTYHCKASSEAGAIRSAPAQLTVLAQGQQ
SCKAAPEPSLVELPAECHQDSGGSRYYDVGHCPSTPCAGSPADGQRCGAGARRCCGVRRM
EMREIRCRGSVLPIKVVAKCGCGPCAQPRVLVQGRVTAADTGEPLRFGQIFLGKKKIGFT
GFQGSFTIEVPPDTQRLVARFVDRQQRLVDAVKVLPFDRRGGAVYQEVKMMRKKEAVELD
AGQINAIPLGEARGQEPIAELVIPAGAFLRPSGEVFKGTVKASVTFLDPRDVATARAASS
DLSFANADGEIVPLRTYGMFAVDFRDGDSGTALQTGPVEVRMDAGQIWMAEHLQKMKLWS
LNPETGLWEEEGVLRPTKERRGRREERTFLVGNMEIRERRLFNLDVPEDRRCFVKVRAYS
NEKFNPYEQLEGVVISLINLEPQPGFPANPRAWGRFDSVVTGPNGACLPAFCDARRPDAY
TAYITATLGGEELEAVPSSPKLNPNAVGVSQPYLNKLGYRRLDHDDPDIKKTAFQVNVAK
PDPNNIDETNGPIYPYRSLRECEEAPVSANHFRFYRVEVDKYEYNVVPFKESDLTSWTGD
YLSWWPNPQEFRACFIKVRIEGPQEYMVRSRNEGGSHPRTLGQLYGLRDARSVRDAMRVG
SSGACLEFKCSGMLYDQSLVDRTLVSVIPQGSCRRTAVNGLLRDYLARHPPVADN
Download sequence
Identical sequences H9H0K1
ENSMGAP00000003054 ENSMGAP00000003054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]