SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003215 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003215
Domain Number 1 Region: 114-325
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-54
Family DBL homology domain (DH-domain) 0.0000797
Further Details:      
 
Domain Number 2 Region: 346-458
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-20
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003215   Gene: ENSMGAG00000003502   Transcript: ENSMGAT00000003914
Sequence length 553
Comment pep:known_by_projection chromosome:UMD2:1:1247563:1271706:-1 gene:ENSMGAG00000003502 transcript:ENSMGAT00000003914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCPLRRGSSFTFLTPGPHWDFTLKRKRRDKDDDVVSLCSLDFKEPSNKRVRPLARVTSLA
NLISPVRNGAVRRFGQTIQSFALRSDSKSPSCAQKSCSRSAAPTPPKRRNSVLWSEMLDV
NMKESLSTKEIKRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDL
DSYIPLHEDLLASLGEATKPDGTVEQIGPILVKWLPRLHAYKGYCSNQLAAKALLDQKKQ
DRRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDIQILEEA
ISIIQGVLSDINLKKGESECQYYIDKLEYLDEKQKDPRIEGSKALLCHGELKNKNGHKLY
VFLFQDILVLTRPVTRNERQSYQVYRQPIPVQELILEDLQDGDVKMGGSFRGAFGNSDKA
KNIFRVRFQDPSPGQSHTLQANDIFHKQQWVNCIRTAIAPFQRPAAATELKELPELSEES
EENNPSVPNVRAQRRQSAMSGITEMELDESTAECGSILDSEEAAKGTKTHRTLSGHRKTR
EKQLSSKRKETLV
Download sequence
Identical sequences G1MWQ9
ENSMGAP00000003215 ENSMGAP00000003215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]