SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003284 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003284
Domain Number 1 Region: 322-575
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.41e-109
Family STAT DNA-binding domain 0.000000000166
Further Details:      
 
Domain Number 2 Region: 136-321
Classification Level Classification E-value
Superfamily STAT 8.63e-63
Family STAT 0.00000000932
Further Details:      
 
Domain Number 3 Region: 576-714
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-42
Family SH2 domain 0.000000187
Further Details:      
 
Domain Number 4 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 6.15e-42
Family Transcription factor STAT-4 N-domain 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003284   Gene: ENSMGAG00000003545   Transcript: ENSMGAT00000003983
Sequence length 771
Comment pep:known_by_projection chromosome:UMD2:29:4511543:4519419:-1 gene:ENSMGAG00000003545 transcript:ENSMGAT00000003983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSAGAAPYLKTKFICVTPTSFS
NTIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMELTQECASSPM
Download sequence
Identical sequences G1MWW8
ENSMGAP00000003284 ENSMGAP00000003284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]