SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003326 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003326
Domain Number 1 Region: 994-1306
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 9.07e-75
Family Complement components 0.0000348
Further Details:      
 
Domain Number 2 Region: 1527-1677
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-42
Family Netrin-like domain (NTR/C345C module) 0.00000457
Further Details:      
 
Domain Number 3 Region: 1395-1528
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.88e-29
Family Alpha-macroglobulin receptor domain 0.002
Further Details:      
 
Domain Number 4 Region: 681-752
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 1.7e-19
Family Anaphylotoxins (complement system) 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003326   Gene: ENSMGAG00000003474   Transcript: ENSMGAT00000004026
Sequence length 1677
Comment pep:known_by_projection chromosome:UMD2:8:8779651:8810947:-1 gene:ENSMGAG00000003474 transcript:ENSMGAT00000004026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAILIYFFVLVFSGTAFGQEKTYVLTAPKVFRVGTTEKVVVQAFGYENEFAVSLALRSFP
DKIVVYSSGHISLNPENNFQNSVTVTLQPTDLAGPEDSVKYVYLEAVSPHFTGLKKIPVS
YENGFLFIHTDKPIYTPDQSVKVRVYSLNEELQPARRETVLTIVDPDGVKVDIIQENDFT
GIVSFPDFKIPPNPKYGIWKIEAKYKKNFITSAVAKFEVKEYAMPSFSIVIEPEHNFISS
DKFENFRIAVKASYFYNKRLAKADVFLRFGIIEGTERRMMPRAMLVTKITNGVAEINFNS
KKAVSSLEFQSLEELDGSFLYIAASVAESMGGLSGEVEFSGVKYAVSPYTLSLIATPLFI
KPGLPFFIKVQVKDTVDHFVGNIPLIITAKSFSQQMDATELISEGSESGRRETSINDGTA
LFVVNIPPDSNLLEFQVKTADPHLSDENQATKTYEARVYSSLSQSYLYIDWASNHKVLNV
GDFISINVYPRSRYIHNIHHYSYLITSKGKIVSFGTQKRIKDLEYEHLSFQITQEMVPSA
RLIVYYIVGEEPAELVADSVWLNVEQKCGSSLDIKLLSSKETHKPAEVVSLNMKTQFDSY
VALSSVDKAIYGVTGRGKGAMKKIMLKLEKSDLGCGAGGGQNNVDVFRMAGLTFLTNANA
DDSNEAGEKCSEVIRTKRSDFEERVLKEASKYKHLEIRKCCMHGVKVYPVSETCSDRARR
IQSHPKCISAFINCCEFANRLREEEPNKLLILARKQFEALLELDETEVRSYFPESWLWEV
HQVSPRYYFSQVTLPDSLTTWEVQGVGISDRGICVAAPLEVQVVKDIFLSIYVPYSVVRG
EQIELKGSVYNHRASAIKFCVKIAVGDGICSSGGSATTGARMHNCDFKNLDAGSSSPIMF
RILPLELGLHTINFTLLTTGSSETVVKTLRVKPEGIKKELHAGFTLDPQGVYGSIKRRQE
FRYKIPLNLVPKTKIDRSVSVKGHLMGEVIATVLSPEGLSILTNLPKGSAEAELMSVAPV
FYVFHYLEASNNWHVLGPETLTSRTQMRRKMKEGIVSILSFRNSDFSYSMWKNGQASTWL
TAFALRILGQVNQYVNLDQISVCNTLLWFIENCQMPDGSFSEFSDYQPVKLQGTLPREAK
EKSLYLTAFSVIGIEKSIKMCPTQKIHDAKNKAGDYLLKNAQSAQSPFTMAIISYALALV
DLNHQAARSLFSALKREASVIGDPPIYRFWKDGFKTPDLHAPSSVTAQMVETTAYALLTA
LLRGDKSYANPIIKWLSEEQRYGGGFYSTQDTVNALEALTEYSLLVKRLHLDMGVKVAYK
NHGDLHVFKLTEDNFVGRAVTVPLDDDIYVSTGSSTGIATINVRTVYNVMGTSEESCNFE
LKIAPKRDNGYRGEDGEPLGHLEACAKYRPSTREPQSGSAHAVMDISLVSGLVANTEDLS
TLASGVDQLIADYEIKDGHVILQIDSVPADRFLCVGFRISQLFHVGMLNPGTFTVYEYHA
PDKRCAVFYNPYGNEKLVRLCEGDECKCMEAECSKVQERLDRSITAGTRREVACQNDIAY
VYKVNILSRSEEGYFVKYSATILDLYKRGQAFAQKNNEITFVKKKTCTDVELSPGMQYLI
MGKEALKINIGYSFRFQYPLDSSTWIEWWPSNPACTFCQEFLNRMEDFVEDLIISGC
Download sequence
Identical sequences G1MWZ9
ENSMGAP00000003326 ENSMGAP00000003326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]