SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003457 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003457
Domain Number 1 Region: 580-772
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.24e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000664
Further Details:      
 
Domain Number 2 Region: 98-365
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.03e-40
Family FCH domain 0.025
Further Details:      
 
Domain Number 3 Region: 511-559
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000194
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003457   Gene: ENSMGAG00000003694   Transcript: ENSMGAT00000004160
Sequence length 974
Comment pep:known_by_projection scaffold:UMD2:GL424683.1:108:12158:-1 gene:ENSMGAG00000003694 transcript:ENSMGAT00000004160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSPFPGLDHQERAPENKKRYSEIFRSLDAIEISIGNATVDMFIGDADGNDYAELTMES
PPTSLREDLSKSKSTSERQMQGDLTVEEADEMLIKCEGGVDAALEYAKMWCKYVKELLSW
IEKRLNYETEFAKGIVKIAESGRNAIIHQSSMPLRALYTMVLEHDIKIGNAASETVGLLQ
QKEFYQPLSAKKNEIEKWRKEFKDQWVKEQKRMNESLSLLRKSRLQYIQRCEELEKAKHL
SAKAEDEYQNSAVISPSSATKQLEKRRRSCEEAQAKVQEAESLYKMCINDANFRRQELEK
VRARIISHIRKLIYQGDEVLTKVTLRMFKQRQTQSEWIPVGYQHLYEVCKPYRVGEKYLE
FIQALQKSSPSNKKKTPLHYTGCSKDGSTPEDTPRRQISPNDAAVIRLQFSAVTPRFAGG
VWSPYPPSAGVNKSLCSDTESLGGSCESRSLDSPSSSPGNSTRKLLKASSTGTMSSSDDF
EERDSLQTSENENGTSQQQSRNALLSSAAQTHRLRKLRGPTKCRECDTFMVNGFECEECY
LTCHKKCLENLLITCGHKKLPNRVPLFGIDFTQVPRDFPEEVPFIVVKCTSEIEARALGV
QGIYRISGSKARVEKLCQAFENGRSLVELSEHSPHDITGVLKHFLKELSGPILPYQFYDN
LIALAKELQKAGEEKVDCMNFPSDPIQSMKDLLSKLPGSNYNTLRHLIAHLYRVAEKYEE
NKMSPNNLGIVFGPTLIRPGSGSDVSMSCLVDSGYQAQIVEFLIQNYERVFGMEDLPSSL
SLGKKPKPKQGSLPPALSPVTFCPPLFPLINNPKGIRGFSAQAVASIELSPSSIHAATAT
LGVKWEASEVNASVGSELEELEEKAGSDSEPVLGTQPRGHFSRQPVKYARAQPKARPHIP
KPSSLPLRASTSPSMATDSGAEGSLTDSTCMERTRSRNSSPDMNALRHRGKQLKHFQITE
ETARIISKFKADEV
Download sequence
Identical sequences H9H0L7
ENSMGAP00000003457 ENSMGAP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]