SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003493 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003493
Domain Number 1 Region: 607-703,741-769
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.39e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 552-601
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000171
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003493   Gene: ENSMGAG00000003755   Transcript: ENSMGAT00000004197
Sequence length 769
Comment pep:known_by_projection chromosome:UMD2:30:2503752:2510697:1 gene:ENSMGAG00000003755 transcript:ENSMGAT00000004197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRKKRELMKTPSISKKSRAGSPIPQTLPVYLLIGDLECKRKRFSSVGRPADGVPQPAP
RDLSRKDCLEAPSPGDLPPTSSKLSSSPSAVGTLKRPTSLSRHASAAGFPLTAANPRAVP
KGHKTPTSHSPMEGGEGPFIDVEDISQLLTDVARFADALENLRDVVLRDDPKESQRPQAH
ECLGETLRVLRQVINKYPLLNTLETLTAAGTLISKVKGFHYESNNETDKREFEKAVETIA
VSFSSTVSEFLMGEVDSSTILSIPPSDQNQSMESLYGGIPGPGGDGVPSGMESYDTVRPA
AEEVDVMLQRCEGGVDAALQYAKNISKYMKDLIGYLEKRTALDCEVALGWGGMILRAPHG
EPKGSQSCWEVPEVLLGGELKYQRVHGEHNTIPTRQGQTLCKAVATAPSGAQPLVSWNVA
QHPACQHVPCVHMSRVSTCPVCPRVLCVHVSAVPRVHTSHVSACPPICLRVPCVSMTPHG
SRCPRCLHVPCVRVSHVSVCPMCQHAKAPYDRRQNADVSLYALPVGINGITPEMAAPTGP
FRNVGLSRAAQTHRLRKLRTPSKCRECNSYVYFQGAECEECYLACHKKCLETLAIQCGHK
KLQGKLQLFGQDFLKASQGSADGIPFIVKKCISEIEKRALKTKGIYRVNGVKTRVEKLCQ
AFENGKELVELSQAPHDISNVLKLYLRQLPEPIVPFRMYNALMGAAKESLQGGSEAKGRS
GKGGPELVDKGADTDRVVVNLVLKLKELLKELPWENMATLQYLLQHLRR
Download sequence
Identical sequences G1MXD0
ENSMGAP00000003493 ENSMGAP00000003493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]