SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003543 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003543
Domain Number 1 Region: 2202-2439
Classification Level Classification E-value
Superfamily Plakin repeat 7.19e-85
Family Plakin repeat 0.00000000243
Further Details:      
 
Domain Number 2 Region: 1960-2195
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-75
Family Plakin repeat 0.00000279
Further Details:      
 
Domain Number 3 Region: 2513-2553,2590-2785
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-63
Family Plakin repeat 0.000000025
Further Details:      
 
Domain Number 4 Region: 837-957,984-1011
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000317
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number 5 Region: 321-450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000108
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 6 Region: 2452-2506
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000217
Family Plakin repeat 0.006
Further Details:      
 
Domain Number 7 Region: 763-875
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000117
Family Spectrin repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003543   Gene: ENSMGAG00000003779   Transcript: ENSMGAT00000004247
Sequence length 2849
Comment pep:known_by_projection chromosome:UMD2:3:11824798:11861653:-1 gene:ENSMGAG00000003779 transcript:ENSMGAT00000004247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRMARADSGTDLRYEMSSHVVGGGGGGTHTHKTYYYQKTYGGDYASDGYGQNGTCTVTRR
QNTIQELLQNCSDCLMRAELIVQPPNPLYLGMGYSLSLSQMVQHYFQMTMNPLVIGLQLI
KSVNQRPRSWNLLFLKLLQLQEQMRALYKAISVPRARRASSKGGGCYSSQSGSGWDEYTK
RVTSECLNWMRQQKAEMELVKWGFDAASIEQQISDHRRTHNAIGDYRWHLDKVKTDLREK
AAVHQLEEEYEGLLKYSFERMDQLRQFQNLIQATSREIMWINDCEEEELLYDWSDRNTDI
SRKQEAFSKRMSELELKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQIT
KCIDVHLKENAAYFQFFEEAQATESYLKNLQDSIRKKFICDKSMSLQSLLEQIKELENER
ERILEYKRQVQSLVNKSRKIVQLKPRNPDYRSNKPIILKALCDYKQDLKTVRKGDECILK
DNNERSKWLVTGPGGVDMLVPSVSLIIPPPNPLAVDLATKIEQYYEAILALWNQLYINMK
SLVSWHYCMIDIEKIRAMTIAKLKTMRKEDYQKIITDLEIHYQEFLRNSQGSEMFGDEDK
RKIQTQFTDAQKHYQTLIIQLPNQPRQPQTVIPTESCPVGTSNTIIVNERNREHDKQEAW
LLMELQKLRRQIEASEIRMVQRAPLGVDQGALHDFSVRIQDLEGVQNDSQIMAETLNKHK
DLLPNFRGCEKYVYLQSEINALFQKLENINGVSAGYLDSLNALRCLLQLILQTEDVIRVF
EVRLSEEETVPLDLDKVEAYRACLKKMKSDLNMKKSLLNTLENELQKMLQIHSQSCQSYT
LYDMDVGKFSDKVTQLIDRWQRAEKQIDNRSWDLERQIKQLKTYRDLYQALCKWICDAKR
RQDSIESTKLCDSNTIMRYLHDQKNLHSEICGKRDKVEELLKHADQCSAAIKDYELQVAS
YSSGLETLLNIPIKKCVVQSPAVLILQEASEAQARYIELLTRSGDYYKFLSEMLKSMEDL
KMKATKIELLEEELRLARDSNSETNNKHKFLEQNLQKYQMDISQLKAKLMSLEEMKRQAE
MDGNSAKQNLDKCYAQIKDLNDRITRLTYETEDEKRKRKLLEDRYEQQKNDYDQLQKTRQ
NEKDSLGWQKLESEKVIKEKEYEIERLRVLLQDEGTRKREYENELAKVRNQFSEEMSNLK
NKYETEINIKKTTIQQIAAQKDDDAKGLRAQVDRLSRENRDLKDEIVRLNDAILQTTDQR
RRAEEDALQQKACSSEVSQQKHQLELELKQIIQLRGEDNSRYKQALEEAAATIQDKTKEL
ERLKLQLQEEAKSRWELENELAKVRNSYDEEIISLKNKYETEINITKTTIHQVTMQKEED
TNNYRTQLDNAMRENRNLCEEIRRLKNTITQTTDNLRKIEENAQQQKAAGSELSQKKQQL
EIELKQVIQRHSDESMRYKQSLDDASKTIKERNKEIERLRKLLDVETSQRKELEDENNQL
KRVQFDLQKANTSATETINKLRIQEQDLARLKIDYERVLQEKKGRDQESAKFQSTVKDLQ
IQKHKLEEELCRQNKNVMEETARRKKLEEEVEGMRRSLREQSVKITNLTQQIEEVSIVKK
RNEDDLRHQREVLDGHVREKQRYMEEIRKYTSDIETLRRQLVQEQEQLKQAHLRNEHLQK
TSEEKSKNLNECKIEIERLQSLTENLTKEHLLLEEELRNVRLEYDDLRMVRSEVDEKNSA
IAELKNQLQTSNKQTLELQGLINDLQKEREKLRQEIEKFQKQALEASNRIQESKNQYNHI
MQERETLLIKMSALEQDKARLQRLEEELNRLKVNLESESRLKQRLENEKQQILNDLNQWK
SQHSRTEESIRKIQCEREKSEREKNTLRSEIERLQMEIKRIEERYRCRLEETAVKNQSEL
ESERLRLQREIEKLKQRPYGSHRSTQTEEDFCIDASKLVFNGLRKKITAMQLYECQLIDK
LTLDKLLKGQRSVEEVTADIEPFLKGAGAIAGVSVLPRQKYSFVEAKRNQLLTAENAVLL
LEAQAATGGVIDPHRNEVLTVDSAIARDLIDFDDREQIYTAEKAVTGFKDPFSGKTVPLS
EAMKKNLIDRETGMRLLEAQLAVGGIVDPVNSVFLPKDVALSRGLIDKDLYRILNNCQST
TKNFIDPSTKKAVTYVQLKEKCRIEPHTGLLLLPVQKRSMSFQGIRQPVSADALLEAGII
KESTRNDLERGAITVEEVSERIINFLQGSSCIAGIYNEATKEKLGIYQAMKIGLVRPGTA
LELLEAQAATGFIVDPVSNARLPVEEAYKRGLVGIEFKEKLLSAERAVTGYKDPETGNII
SLFQAMNKELIERGHGIRLLEAQIATGGIIDPKESYRLPVETAYKRGYFNEELNQILSDP
SDDTKGFFDPNTEENLTYLQLKERCIKDDATGLCLLPLREKKKVVHTSQKNTLRKRRVVI
VDPETNREMSVQEAYSKGLIDFDTYTELAEQECEWEEITITGSDGSSRVVLVDRKTGSQY
DIQDAIDKGLVEKKFFDQYRSGSLSLTQFADMISCRNGTDEVFRHESVTRSPTVLSVRSS
SSLIRSGSFSETPDECSPIAAIFDTENLEKISISEAIQRGIVDSITGQRLLEAQACTGGI
ICPTTGQRLSLQEATSQGIIDQDMATRLKPAQKAFIGFEGIKSGRKRMSAAEAVKEKWLP
YEAGQRFLEFQYLTGGLVDPEVRGRISIEEAIRNSLIDGRAAQKLQDTNSYPKILTCPKT
KLKISYKDAMNRSMVEDITGLKLLEAASVSSKGISSPYNVSSAPGSRSGSRSGSRSGSRS
GSRRGSFDASATSSYSYSYSTFSSGSIGR
Download sequence
Identical sequences G1MXH6
ENSMGAP00000003543 ENSMGAP00000003543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]