SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003571 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003571
Domain Number 1 Region: 47-174
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-51
Family Phosphotyrosine-binding domain (PTB) 0.0000565
Further Details:      
 
Domain Number 2 Region: 492-563
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000112
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003571   Gene: ENSMGAG00000003800   Transcript: ENSMGAT00000004275
Sequence length 722
Comment pep:known_by_projection chromosome:UMD2:5:6100057:6126857:1 gene:ENSMGAG00000003800 transcript:ENSMGAT00000004275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKGSLSSSPGSTNGSVGKADGASKLSAKDLYEQRKKYSNSNIIMHETSQYHVQHLATF
IMDKSESIVTVDDAIRKLLLLNSKEKIWTQEMLLQVNDKSIRLLDCESQEELEDFPLPTV
QHCQTVLNQMRYSSILLLVCQDSEQHKPDIHFFNCDEVEAEMVHEDIESALADHKHGKKI
RPQTLKANQEKIKQRQSILPPPQGPAPIPIQHDMRGQAMNRNRVAPPAQYEPGTGRAQYQ
DHEESRAILAQKIEKETQILNCTLDDIEVFVARLQKAAEAFKQLNQRKKGKKNKKKGPAE
GMLTLRARPPSEAEFIDCFQKTKLAFNLLAKLRKHIQNPSASELVHFLFGPLELIINSCG
GPELARSVINPLLSKDATDFLKGHLTPKEISLWDSLGEAWTRSRAEWPREANIPTYIPKF
RNGWEPPIEIFRGAPWEIDIGHLQEELSSANGYPYRNSSLKRGQAADQTQAVDAFKQNVT
QHHKNFEAQGMAQPKRYAKIRYDFTARNANELSVLKDEILEVLEDNKQWWKLLNRSGQAG
YVPYNILDVVKLEELEQVCNQANQRYKGDPGPRGYGPSSPTHKLPASYAGDKWGKLLHQM
DEVNDELLKKITNSKIQPPQRNFRVEKPQEVFVPLTFESSAEEVKAWLEAKSFSKGTVEH
LGILTGAQLFSLNREELKKVCGDEGNRVYSKITVEKNQLEKNRGETELQEIMKRRQERID
SA
Download sequence
Identical sequences G1MXJ6
ENSMGAP00000003571 ENSMGAP00000003571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]