SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003580 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003580
Domain Number 1 Region: 372-589
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-37
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 236-340,375-400
Classification Level Classification E-value
Superfamily SH2 domain 1.38e-20
Family SH2 domain 0.0017
Further Details:      
 
Domain Number 3 Region: 125-225
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-20
Family Third domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003580   Gene: ENSMGAG00000003834   Transcript: ENSMGAT00000004284
Sequence length 592
Comment pep:novel scaffold:UMD2:GL424725.1:19242:22708:-1 gene:ENSMGAG00000003834 transcript:ENSMGAT00000004284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVIDYLFAQSRSDFIAGRMELALSLAGQEECLSLAVLDMLRIAKEKWQSPEQVFSCISYK
SCIPEPLRCQIQQHSFLTRKRIRRRVAQSLRRMGGCRADGRCLKLKYLLDLERLRRCWAE
ESFHARGPDADITIHVSADSGVSWSCGGSESHQHFCDFPDIADVSIKQASRDGGPVENRI
VTLTKTDNRVLEVEFPTLREALSFVALVDGYYRLTADAHHYFCKEVAPPRLLEDIENQCH
GPISSEFAVRKLKAAGAQPGLFVLRRSPQDFDSFLLTVCTETRSGQDFKRCLIRRDEDGS
FWLTGLARRFCSLQELLGTYGRCGLQAEGAYLRLDTCCPPLPREKSNLLIVRSGCPRPPN
SPPAPRRSPSQMTFHKIDPESLIRGESLGQGSFTHIYKGVKRDQKDDEFYQTPVVLKVMD
SSHRNCSESFLEAASIMSQLSHKHLVLLHGVSLGKDSIMVQEYIRHGPLDLYLKKNHSEG
KVTTSWKLQVAKQLAYALNYLEDKKITHGNVSAKKVLLTRRGRGQRQPPFIKLNDPGVSI
TVLAKELLVERIPWVAPECLSEPQSLALPADKWSFGATLWEIFSGGNMPVSL
Download sequence
Identical sequences H9H0M3
ENSMGAP00000003580 ENSMGAP00000003580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]