SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003601 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003601
Domain Number 1 Region: 2-187,309-389
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.93e-57
Family Bacterial dinuclear zinc exopeptidases 0.0000000108
Further Details:      
 
Domain Number 2 Region: 182-292
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000000139
Family Bacterial exopeptidase dimerisation domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003601   Gene: ENSMGAG00000003829   Transcript: ENSMGAT00000004305
Sequence length 396
Comment pep:novel chromosome:UMD2:14:2981377:3120447:-1 gene:ENSMGAG00000003829 transcript:ENSMGAT00000004305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFREYLRIDTVHPKPDYAPDAAVQFLERVGTDLGLACQKVEVCQGRVVLVLTWPGTNPRL
RSILLNSHTDVVPVFEEHWTYPPFEAVKDSQGNIYARGAQDMKCVSIQYLEAIRRLKAEG
KSFARTIHLSFVPDEEVGGHKGMVMFLQRPEFKALNVGFALDEGLASPSDTYSVFYGEKS
PWWIKVKCTGSPGHGSRFITNTAAEKLHKVITSFLAFRESEKQRLKSNTSLTLGDVTSLN
LTMLEGGVSFNVVPSEMAVGFDVRIPPTVDLKAFEEQVAAWCRAAGDGVTYEFHQKCMDQ
QITSTEESDPWWKAFSGVCRDMKLPLKLEIFPAATDSRYIRAAGYPALGFSPMNRTPVLL
HDHNEFLNEDVFLRGIDIYARLLPALASVPPLPAEG
Download sequence
Identical sequences G1MXL7
ENSMGAP00000003601 ENSMGAP00000003601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]