SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003606 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003606
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000002
Family Pyrin domain, PYD 0.016
Further Details:      
 
Domain Number 2 Region: 568-734
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000157
Family 28-residue LRR 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003606   Gene: ENSMGAG00000003857   Transcript: ENSMGAT00000004310
Sequence length 734
Comment pep:novel chromosome:UMD2:5:6155547:6184046:1 gene:ENSMGAG00000003857 transcript:ENSMGAT00000004310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEESAILLEALEGLTLEDFQEFKKKLSHIDIKEGWNIHRDELEKFTHPSTLISYMGDS
YGEAAAMDIAIGLFEKMNQRHLAEKILDEKVKEYKQKYREHVAREFLQYKEVNSWLGENL
SVSDRYTNLTIARRSWNQHGGEPGDVSSDTVTIQTLFEPSKDGQLQRVTVLVGATGMGKT
MTIRKVMMDWVEGTLCTQFDYAFCIDCKELSFSKEVSMVDLISKCCPQQRTPAGRIFDNP
EKILFIFDSFEVLGLPLVQHKGELSTDPTEAKPLETTLLSLLKRKVLPESSVLIAMRPTA
LQSLGQCLEGEHYVEILGFAPAAREEYFHRYFGNDNKADVAFRFTRGNGVLYSLCVIPIM
SWTVCTILEQELHKRNQLLACSKTTTQMILFYLSWLTKHRVSNAWQNLQQFLHKLCSLAA
DGIWKHKVLFEEKEIEDQGLNQPELLSLFLNEKGLEKGTHHGNVYSFSHLHLQEFFAAMF
YVLEDQEEMLSDSQIFAKDVNMLLKSYHTSRMDLNVTVRLLFGLVNPKSVEYADEGIGCR
ISLRPREDLLRWLQTRHRDLSHPSKIMTVKDLDTFHFLFETNEESFVQSVLGSFTGIVLQ
DAKLMLYDQVALCFCIKQWAGLLSVTLRSCSFHQQHRRQEPGKGLPWQSWRQEELHSPLY
PLCQALRHPGSLLQSLRLQWCGLTEGDSKTLGTLLATLPSLVYFEVGDGALGDDGVRMLC
TGLRQPDCHLRVLR
Download sequence
Identical sequences G1MXM2
ENSMGAP00000003606 ENSMGAP00000003606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]