SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003671 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003671
Domain Number 1 Region: 36-155
Classification Level Classification E-value
Superfamily E set domains 0.0000000145
Family RhoGDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003671   Gene: ENSMGAG00000003927   Transcript: ENSMGAT00000004376
Sequence length 160
Comment pep:known_by_projection chromosome:UMD2:3:12194131:12217925:-1 gene:ENSMGAG00000003927 transcript:ENSMGAT00000004376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLNVLALILVLLCTNASTEWPTHTVCKEENLEIYYKSCDPQQDFAFSIDRCSDVTTHT
FDIRAAMVLRHSIKELYVKIDLIINRKTVLSYTETLCGPGVSKLIFCGKKKGEHLYYEGP
VTLGIKEIPQGDYTIAARLTNEDHVTVACADFTVKNYLDY
Download sequence
Identical sequences G1MXR9
ENSMGAP00000003671 XP_010706696.1.16129 ENSMGAP00000003671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]