SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003705 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003705
Domain Number 1 Region: 576-763
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-53
Family DBL homology domain (DH-domain) 0.000000115
Further Details:      
 
Domain Number 2 Region: 767-897
Classification Level Classification E-value
Superfamily PH domain-like 8.21e-36
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 3 Region: 266-407
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000317
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 4 Region: 94-175
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000916
Family CRAL/TRIO domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003705   Gene: ENSMGAG00000003860   Transcript: ENSMGAT00000004411
Sequence length 943
Comment pep:known_by_projection chromosome:UMD2:9:4585128:4617182:-1 gene:ENSMGAG00000003860 transcript:ENSMGAT00000004411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKLHLVLLHLFFSSETTAPIRAKDISDELMKQFAFLSGGRGKDKAWIITLPDNSRFNDVP
EDVVTKVLTYLTSVPSQHESDTKFILILDRRLDTWTSVKTTLQKIAASFPGNLHLVMVLR
PTGFFQRTFTDIGFRFSQEDFLLKLPVVMLSSVSDLLTYIDEQQLTPEFGGTLEYCHSEW
VIFRTAIENFALTVKEIAQMLQSFGTELAETELPEDMYSIERILALRTEKYFQLKEDITA
VTKEGKLLLSNLEEPDVGECSQDQHQRPGDWDTVNRLLGQLREMETAFDGFWEKHQLKME
QYLQLWKFEQSFQEVKNAIEFLMGQQAELPDTGDSVSQVKQRLKDLSHFDGLAQDLIGKA
QVVILHGHQLAANHHYALNLICQQCNELRHHSDVLSDEIKRKQMRLQKTLDLHTRLQQAL
QCCDEGAYLLANQQMDKCQSKEGAQKALQDIERFLESSSPYLNYDPQSLQYDFESVLTAE
LKCQIQSVQVKLENVRSMFENRQSCFKKLLDKHVRPVQLVAPRPENPPRSKSPLFSPKHG
KKTSRKTPSSRKIEVMHDYQEKRNSLQSFISDSDDNLDILKGHVINELIETERVYVEELF
TVLTGYRAEMDNPAMVILMPPVLRNRKDVLFGNMPEIYDFHNKIFLHSLESCLGAPERVG
FCFLDRREDFQMYEKYCQNKPRSESLWRQCSESTFFQECQRKLEHKLGLDSYLLKPVQRL
TKYQLLLKELLKYSTSCDGVQELQEALVAMLDLLKSVNDSMHQISITGYDGDLSELGKVL
MQGSFSVWTGHRKGPTKMKDLARFKPMQRHLFLYEKALVFCKKREDHGDGYDKTSSYSFK
HFLKMNAVGITENVKGDHRKFEIWYSGREEVYVVQAQTVDLKMAWLNEIRKILFKQQELI
KVEKQQPSSCTDQLHLSSQLSDGKQQRASISSEENDSERTSPV
Download sequence
Identical sequences G1MXU3
ENSMGAP00000003705 ENSMGAP00000003705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]