SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003766 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003766
Domain Number 1 Region: 388-563
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.59e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000969
Further Details:      
 
Domain Number 2 Region: 565-665
Classification Level Classification E-value
Superfamily E set domains 1.51e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003766   Gene: ENSMGAG00000003992   Transcript: ENSMGAT00000004474
Sequence length 1054
Comment pep:known_by_projection chromosome:UMD2:13:3076309:3117989:-1 gene:ENSMGAG00000003992 transcript:ENSMGAT00000004474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDLESDDCASIYIFNVDQPSSSVNQPICIPRHGLQSHSSPLSPPTRLQSHKNYEGTGEVP
ESKYSPLGGPKPFECPSIQITSISPNCHQGIEANEDELHTNGTENEYMERPSRDHLYLPL
EPSYRESSLSPSPASSISSRSWFSDASSCESISHVYDDVDSELNEAAARFTLGSPLASPG
GSPRGPNDESWQQPYGFGHALSPRQSPCHSPRTSITDENWLSPRPTSRPSSRPTSPCGKR
RHSSAEICYAGSLSPHHSPTPSPGHSPRGSITEDTWLNTSIHNVQGLNSGLSPFQCCTET
DIPLKTRKTSEDQTATLSGKIDICPEEQGNLSSSLENAVDDCSGSQHTLKKDLPGDQFLS
VPSHFTWNKPKPGHTPIFRTSSLPPLDWPLPSHYGQCELKIEVQPKTHHRAHYETEGSRG
AVKASTGGHPVVKLLGYSEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEII
IASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQ
PSGKVLSLQTASIPVECSQRSAQELPQIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFF
EKGQDGRPQWEVEGKIIREKCQGANIILEVPPYHNKTITAAVQVQFYLCNGKRKKSQSQR
FTYTPVIMKQEHRDEVDLSTVPSLALPHTSNVQGLHSIRTQLPSPEQGHPHDNLLSTSPR
SLVCPVQPPYTAMVTSAVSHLSHMQGRNLSPSEECHVLPPAVVQSFQVTSAPPVRPSYQP
MQSSDVYNEQSGLPMNSASSQGFDAISFQQDTAVPHLINLSCQALPPMPFHSSNPGSVST
SSTAGHPLARSAHSGQSSSHLPSMGYHCPSAGQASLPSAMSRSLGQSSPQLQQVPYHSTN
PASTSPSPTASHPLVHSPLSGPSSPQLQPMPYQSPSSGPASSPPPATVSQSGQHSPQAHS
PALGGLNAASSLVHHPVCDSSPFSPDGAAINIKPEPEDRELNFQIGLQDITLDDVNEIIG
RDMSQISVSHGTTVATQSPCTCPGSLETRISDGI
Download sequence
Identical sequences G1MXY9
ENSMGAP00000003766 ENSMGAP00000003766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]