SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003801 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003801
Domain Number 1 Region: 137-252
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-28
Family Phosphotyrosine-binding domain (PTB) 0.00055
Further Details:      
 
Domain Number 2 Region: 4-113
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000179
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003801   Gene: ENSMGAG00000004040   Transcript: ENSMGAT00000004509
Sequence length 428
Comment pep:known_by_projection chromosome:UMD2:15:9785544:9788056:-1 gene:ENSMGAG00000004040 transcript:ENSMGAT00000004509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPVKDGILYVQHCKFGKRTWRKMRAQLFAASPFGVARMEKFDARDDGTVPDTSLRRCT
RRVIRLSDCVSVGPMGTENCPKATAAFYLTTTEKNYVLAADQRDEWIEQLCQLAFQVKKE
AAQSSSTGLQPIPMEENCLYSSWQDLTEFPVLVLRTEAATRCKLHGHYVLAALPQSLTLK
DAQSQQPLLTWPYPFLRKFGQDQNIFSFEAGRRSDSGEGTFTFSTPRAPELCRAVATAIA
CQQQGRESPQPQLSAQGLSTQPWGAEAEDPQHSPTLGRAQSGSYSASHPSPNLLRFPAVE
PEAAGPILYASIARGQQPHFTPCPGKPLPEHLYENIFTAQPRPLAEEEEEEEEGRWELGC
RQAPEGHSSEATVSYPARSAPQPHRQRWGPGGSGGDAEERSRPKPQRTLRAKLVRLLSRD
GPGARDWS
Download sequence
Identical sequences G1MY17
ENSMGAP00000003801 ENSMGAP00000003801 XP_003210382.1.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]