SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003899 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003899
Domain Number 1 Region: 379-683
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-94
Family Protein kinases, catalytic subunit 0.000000000076
Further Details:      
 
Domain Number 2 Region: 4-117
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.83e-25
Family PLC-like (P variant) 0.000082
Further Details:      
 
Domain Number 3 Region: 209-279
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.3e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00018
Further Details:      
 
Domain Number 4 Region: 137-205
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.03e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003899   Gene: ENSMGAG00000004059   Transcript: ENSMGAT00000004608
Sequence length 708
Comment pep:known_by_projection chromosome:UMD2:1:3824923:3853982:-1 gene:ENSMGAG00000004059 transcript:ENSMGAT00000004608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGLSNYDSXGEVINPYCAVMVKEAVESENGQVYVQKKPTMYPPWNSTFDAHINN
GRVMHIVVKDKSAEMVSETTVELKVLAERCKKSNGKTEIWLELKPQGRMLMNARYFLEIS
DAKDLTDCENEAFFSLHQRRGAIKQAKIHNVKCHEFTATFFPQPTFCSVCHEFVWGLNKQ
GYQCRQCNAAIHKKCIDKVIAKCTGSAVNSRETMFHKERFKIDMPHRFKVYNYKSPTFCD
HCGTLLWGLARQGLKCDACCMNVHHKCQTKVANLCGVNQKLMAEALALIGSTQQARCQRD
TEQISRDGPLEIGFPVLVREVTSLQAVPASTTGKKEPQGISWETPVEGTTKGVSLIETDL
GGKQLLEQQEDQVQLKLTIEDFVLHKMLGKGSFGKVFLAELKNTDQYFAVKALKKDVVLM
DDDVECTMVEKRVLSLAWDHPFLTHVFCTFQTKENLFFVMEYLNGGDLMFHIQSCHKFDL
PRATFYAAEIISGLQFLHLKGIIYRDLKLDNVLLDSEGHIKIADFGMCKENMFGDAKTST
FCGTPDYIAPEILLGQKYNTSVDWWSFGVLLYEMLIGQSPFHGQDEEELFQSIRMDNPFY
PRWLDKDAKDILVKLFVREPERRLGARGNIRQHAFFREINWEALEERRMEPPFKPRVKSP
SDCSNFDKEFLSEKPRLSCADRALINSMDQNMFRNFSFVNPKMENIFS
Download sequence
Identical sequences G1MY89
ENSMGAP00000003899 ENSMGAP00000003899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]