SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000003984 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000003984
Domain Number 1 Region: 224-504
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.12e-53
Family Pancreatic carboxypeptidases 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000003984   Gene: ENSMGAG00000004206   Transcript: ENSMGAT00000004694
Sequence length 551
Comment pep:known_by_projection chromosome:UMD2:5:6213271:6215575:-1 gene:ENSMGAG00000004206 transcript:ENSMGAT00000004694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREPRALFALPSARGPLPAPRWPIECEVIKETIKHIEWIPPEPEPFCQPTDPPLATKGLL
GVLSPAVPSALRLLLPPVLGLGGPPGPLSSPAAILEDLQDNTLLFESRFECGNLQKAVKV
GPYEYVLTLRPDLYTTKHTQWFYFRVQNTRKDTIYCFTIANLAKPKSLYGKGMCPLFYSQ
KDAQSHGIGWRRIGNNIRYYRGNSGGEPAAFCLSWSTCFPHDSDMCYFAHSYPYTYSDLQ
RYLQTVMGDPARSQYCVVRTLCHSLAGNIVYMLTITAPSSGAAKRAVVLSARVHPGESGG
SWAMQGFLDFILSAAPDAQLLRQLFVFKVVPMLNPDGVVVGNSRCSLAGRDPNRAYRTGS
RGSFPAIWHLRAMVERLLVEREVVLYCDFHGHSRKNNVFMYGCDGSRDGSETRLQERIFP
LMLSKNAPDKFSFSSCKFKVQKSKEGTGRVVMWRMGIANSYTLEAAFGGSTLGEDGRNSH
FTVEDLKSLGYYLCDTLLDFCDPNPAKFQQCLAEVDALLRPRLGSGQSWSDIATSQLESS
TSGSDSSVSDG
Download sequence
Identical sequences G1MYG3
ENSMGAP00000003984 ENSMGAP00000003984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]