SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004015 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMGAP00000004015
Domain Number - Region: 41-153
Classification Level Classification E-value
Superfamily E set domains 0.00287
Family Arrestin/Vps26-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004015   Gene: ENSMGAG00000004241   Transcript: ENSMGAT00000004725
Sequence length 326
Comment pep:known_by_projection chromosome:UMD2:8:12205833:12213239:1 gene:ENSMGAG00000004241 transcript:ENSMGAT00000004725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFLGGFFGPVCEIDVILNDAETRKTAEMKTEDGKVEKHFLFYDGESVSGKVNVSKQHGK
RLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESY
IGANVRLRYFLKVTIVRRLSDIVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYN
KSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPV
KGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEK
LRKQRTNFHQRFESPESQASAEQPEM
Download sequence
Identical sequences G1MYI5
ENSMGAP00000004015 ENSMGAP00000004015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]