SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004041 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004041
Domain Number 1 Region: 101-255
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-37
Family Spectrin repeat 0.00000151
Further Details:      
 
Domain Number 2 Region: 208-363
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-35
Family Spectrin repeat 0.00000136
Further Details:      
 
Domain Number 3 Region: 2-149
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-31
Family Spectrin repeat 0.00000155
Further Details:      
 
Domain Number 4 Region: 313-468
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-30
Family Spectrin repeat 0.00092
Further Details:      
 
Domain Number 5 Region: 475-536
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000489
Family Spectrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004041   Gene: ENSMGAG00000004093   Transcript: ENSMGAT00000004752
Sequence length 537
Comment pep:known_by_projection chromosome:UMD2:19:5277824:5353809:1 gene:ENSMGAG00000004093 transcript:ENSMGAT00000004752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSLIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFD
FWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFD
TSQVKDKRETINGRFQRIKSMAAARRAKLNESHRLHQFFRDMDDEESWIKEKKLLVSSED
YGRDLTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVDH
WKELKQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKK
HEAFETDFTVHKDRVNDVCANGEDLIKKNNHHVENITAKMKGLKGKVSDLEKAAAQRKAK
LDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQE
GIANITALKDQLLAAKHIQSKAIEARHASLMKRWNQLLANSAARKKKLLEAQEHFRKVED
LFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFN
Download sequence
Identical sequences G1MYK8
ENSMGAP00000004041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]