SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004061 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004061
Domain Number 1 Region: 83-254
Classification Level Classification E-value
Superfamily E set domains 4.97e-35
Family Arrestin/Vps26-like 0.02
Further Details:      
 
Domain Number 2 Region: 8-95
Classification Level Classification E-value
Superfamily E set domains 9.8e-17
Family Arrestin/Vps26-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004061   Gene: ENSMGAG00000004224   Transcript: ENSMGAT00000004773
Sequence length 322
Comment pep:known_by_projection scaffold:UMD2:GL424873.1:62:1995:-1 gene:ENSMGAG00000004224 transcript:ENSMGAT00000004773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRPPSVLPTDNGEVTVLQAGRHEFPFTFQLPETLATSFEGKHGSVRYWVKAKLHRPWATV
KKVKKEFTVIEPIDINTPALLAPQAGAKEKLARAWYCNRGQVSVTAKIDRKGYTPGEVIP
IFAEIDNCTNRAVVPKAAIIQTQTFIARGTKKQKKSVVTSIVGDSIAAGKREVWHGRALK
IPPVGPSILQCRIIQVEYSLKVCVDIPGTSKLLLELPLVIGTIPLHPFGSRTSSVSSQYS
ITLDWLSSIPEQPEAPPEYSAVVPSPTAEQSLAPPCRSELGAVLEGPFFAYIQEFRFRPP
PLYSEVDPNPPSDGIRPRCMTC
Download sequence
Identical sequences H9H0N6
ENSMGAP00000004061 ENSMGAP00000004061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]