SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004143 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004143
Domain Number 1 Region: 67-251
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.09e-74
Family T-box 0.000000649
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004143   Gene: ENSMGAG00000004357   Transcript: ENSMGAT00000004856
Sequence length 257
Comment pep:known_by_projection chromosome:UMD2:5:6321736:6323232:-1 gene:ENSMGAG00000004357 transcript:ENSMGAT00000004856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNLALTQNAGTLPPPPRCPHHSSCAAGPTAVWELPPIPSVTCNAPGWACEGPEASGKNRR
VCHAMARLEMGNLWEEFNRLGTEMIVTKAGRRMFPTFQVKLSGLDPLADYALVMDFVPLD
DKRYRYAFHSSSWLVAGRADPAAPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNNLLDDN
GHIILNSMHRYQPRFHVVLVDPRRDSERFAHQNFKSFSFPETQFMAVTAYQNHRITQLKI
ASNPFAKGFRDGELEPW
Download sequence
Identical sequences G1MYT5
ENSMGAP00000004143 ENSMGAP00000004143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]