SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMGAP00000004215 from Meleagris gallopavo 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMGAP00000004215
Domain Number 1 Region: 2-204
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.55e-57
Family DBL homology domain (DH-domain) 0.00003
Further Details:      
 
Domain Number 2 Region: 191-309
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-22
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMGAP00000004215   Gene: ENSMGAG00000004413   Transcript: ENSMGAT00000004928
Sequence length 715
Comment pep:known_by_projection chromosome:UMD2:5:6248082:6252573:1 gene:ENSMGAG00000004413 transcript:ENSMGAT00000004928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLQRVLLEIVESERTYARDLRGIVEGYLGKIIDAQEPPLRPEQVSALFGNIEDIYELSS
NLLQSLESCACDPVAVAVCFVTRSQEFDIYTQYCNNYPNSVATLSECMRSKQQARFFREC
QEEMRHVLPLGAYLLKPVQRILKYHLLLQEIAKHFEHKSGDDYEVVVEAIDTMTCVAWYI
NDMKRKHEHAIRQQEIQSLLLQWKGPDLTTYGELVLEGSFRAQRARSERAVFLFDKLLLI
TKRRGDHYVYKSHIPVRVRSQPGGPGGGQSGTKFEHRSQGWELVQAKSAEEKRVWTHHIK
RLILENHHAIVPQKAKEAILEMDLFYPPRLPRCSPEHLPRSHSCQPLEPPRHGRRQSEPF
QYRDRAETLPDRLQEHVGRRQSEPAKQILQQLGRMKHAGSEGTLLDAGEPLQPTISWAEG
VVEEEEEEEEKPLQKDSHEDGDRDKNGDMTEKPQEEQVSSPLGWPTSLKERTAGVVILTA
AAPSTFPLAGHLETTATPMSPVSPPCHGEHEGLGTPAPPSPSGSLPPAGLPDEEEQHPET
GTGEDPRALSSEEEEEEEEEEGHGSGSILPPSVLDQASVIAERFGSSMSRRGSMVLDGRS
GSALSLDGVTPPQENMESCSPLPSPGSPQGCRRRSLLSTQDRLLLRKIRSYYEHAEHQDA
GFSIRRRESLSYIPKGLVRNSVSRINSWPPLEPGSPKTPTEPVSPKVLLEPGSPK
Download sequence
Identical sequences G1MYZ3
ENSMGAP00000004215 ENSMGAP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]